DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEL and rps6ka3

DIOPT Version :9

Sequence 1:NP_066956.1 Gene:RNASEL / 6041 HGNCID:10050 Length:741 Species:Homo sapiens
Sequence 2:XP_031752603.1 Gene:rps6ka3 / 100496161 XenbaseID:XB-GENE-480947 Length:737 Species:Xenopus tropicalis


Alignment Length:702 Identity:135/702 - (19%)
Similarity:229/702 - (32%) Gaps:259/702 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    73 DIVELLLRH-------GADPVLRKKNGATPFILAAIAGSVKLLKLFLSK---GADVNECDFYGFT 127
            :|.|:.:.|       .|||        :.|.|..:.|.....|:||.:   |.|.         
 Frog    43 NINEIAITHHVKEGHEKADP--------SQFELLKVLGQGSFGKVFLVRKISGTDA--------- 90

Human   128 AFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLK------- 185
                    |::.|:|.|.|....|..|.:||.:::.|           .|..|..::|       
 Frog    91 --------GQLYAMKVLKKATLKVRDRVRTKMERDIL-----------VEVNHPFIVKLHYAFQT 136

Human   186 -----ILLDEM-GADVNACDNMGRNALIHALLSSD----DSDVE---AITHLLLDHGADVNVRGE 237
                 ::||.: |.|            :...||.:    :.||:   |...|.|||...:.:...
 Frog   137 EGKLYLILDFLRGGD------------LFTRLSKEVMFTEEDVKYYLAELALALDHLHSLGIIYR 189

Human   238 RGKTPLILAVEKKHLGLVQRLLEQEHIE-------------------IN---DTDS--------- 271
            ..|...||..|:.|:.|....|.:|.|:                   :|   .|.|         
 Frog   190 DLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVL 254

Human   272 --------------DGKTALLLAVELKL----------KKIAELLCKRGASTDCG---DLVMTAR 309
                          |.|..:.:.::.||          :.:..:|.||..:...|   |.|...:
 Frog   255 MFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLTPEAQSLLRMLFKRNPTNRLGAGPDGVEEIK 319

Human   310 RNYDHSLVKVL---------------LSHGAKED---FHPPAEDWKPQSSHWGAALKDLHRIYRP 356
            |   |.....:               .:.|..||   |.|......|:.|....|..:.|:::| 
 Frog   320 R---HPFFATIDWNKLYRRENQPPFKPATGGPEDTFYFDPEFTAKTPKDSPGIPASANAHQLFR- 380

Human   357 MIGKLKFFIDEKYKIADTSEG--------GIY-----------------------LGFYE----- 385
               ...|       :|.|||.        |::                       :|.|.     
 Frog   381 ---GFSF-------VAITSEDENQAMQTVGVHAIVPLHRNSIQFTDGYELKEDIGVGSYSICKRC 435

Human   386 -----KQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCE--QTLEA 443
                 ..|.|||...:.......|:..|....::.:::|.........::::...|.:  :.|:.
 Frog   436 IHKGTNMEYAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVYLVTELMKGGELLDK 500

Human   444 CLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNIL-ID---SKKAAHLADF 504
            .|   |.:.....|   |..||.:|.|.|:.|| |....|:||:|.||| :|   :.::..:.||
 Frog   501 IL---RQKFFSERE---ASAVLHTITKTVEYLH-SQWVVHRDLKPSNILYVDESGNPESIRICDF 558

Human   505 DKSIKWAGD---------------PQEVKR-------DLEDLGRLVLYVVKKGSISFEDLKAQSN 547
            ..:.:...:               |:.:||       |:..|| ::||.:..|...|.:....:.
 Frog   559 GFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLG-VLLYTMLTGYTPFANGPDDTP 622

Human   548 EEVVQL--------------SPDEETKDLIHRLFHPGEHVRDCLSDLLGHPF 585
            ||::..              |..:..|||:.::.|...|.|...:.:|.||:
 Frog   623 EEILARIGSGKFSLSGGYWNSVSDIAKDLVSKMLHVDPHQRLTAAQVLKHPW 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNASELNP_066956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ANK repeat 24..56 CDD:293786
ANK 1 24..53
Ank_2 29..122 CDD:289560 14/58 (24%)
ANK 2 58..87 6/20 (30%)
ANK 59..188 CDD:238125 27/136 (20%)
ANK repeat 59..89 CDD:293786 6/22 (27%)
ANK repeat 91..122 CDD:293786 8/33 (24%)
ANK 3 91..120 8/31 (26%)
Ank_2 96..199 CDD:289560 25/118 (21%)
ANK repeat 124..154 CDD:293786 6/29 (21%)
ANK 4 124..153 6/28 (21%)
ANK repeat 167..199 CDD:293786 7/44 (16%)
ANK 5 167..197 7/42 (17%)
Ank_2 172..270 CDD:289560 26/139 (19%)
ANK 196..321 CDD:238125 33/204 (16%)
ANK repeat 201..236 CDD:293786 9/41 (22%)
ANK 6 201..234 9/39 (23%)
2-5A binding (P-loop) 1 229..242 1/12 (8%)
ANK 7 238..268 10/51 (20%)
Ank_2 243..326 CDD:289560 24/155 (15%)
2-5A binding (P-loop) 2 253..275 8/66 (12%)
ANK repeat 272..326 CDD:293786 13/81 (16%)
ANK 8 272..301 7/38 (18%)
ANK 9 303..329 7/43 (16%)
PKc_like 375..587 CDD:304357 58/294 (20%)
Pkinase 387..586 CDD:278497 53/241 (22%)
RNase_RNase-L 590..708 CDD:199218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..741
rps6ka3XP_031752603.1 STKc_RSK_N 69..385 CDD:270734 67/369 (18%)
STKc_RSK2_C 399..737 CDD:271078 56/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.