DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEL and camk1g

DIOPT Version :9

Sequence 1:NP_066956.1 Gene:RNASEL / 6041 HGNCID:10050 Length:741 Species:Homo sapiens
Sequence 2:XP_004910791.1 Gene:camk1g / 100494644 XenbaseID:XB-GENE-6085002 Length:733 Species:Xenopus tropicalis


Alignment Length:453 Identity:98/453 - (21%)
Similarity:161/453 - (35%) Gaps:146/453 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   317 VKVLLSHGAKEDFHPPAED---WKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGG 378
            |..|...|.||:     ||   ||.|:::    :::.. ::..::|...|  .|.|.:...|.| 
 Frog    16 VSTLDKSGHKEE-----EDGSIWKKQTNN----IRETF-VFMEVLGSGAF--SEVYLVKHRSTG- 67

Human   379 IYLGFYEKQEVAVKTFCE-GSPR---AQREVSCLQSSRENSHLVT---FYGSESH---------R 427
                    |..|:|...: .|.|   .:.|::.|:..: :.::||   .|.|.||         .
 Frog    68 --------QHYALKCIKKVNSSRDKSLENEIAVLKRIK-HENIVTLEDIYESSSHFYLVMQLVSG 123

Human   428 GHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNIL 492
            |.||      ::.||      ||  |..|:|  |.||:..:..||:.|| ..|..|:||:|:|:|
 Frog   124 GELF------DRILE------RG--VYTEKD--ASNVIRQVLSAVKYLH-DNGIVHRDLKPENLL 171

Human   493 I---DSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLS 554
            .   |......:.||..|            .:|:.|.:.......|.::.|.|..:...:.|   
 Frog   172 YLTPDENSKIMITDFGLS------------KMEENGIMSTACGTPGYVAPEVLAQKPYSKAV--- 221

Human   555 PDEETKDLIHRLFHPGEHVRDCLSD-------LLGHPFFWTWESRYRTLRNVGNESDIKTRKSES 612
                                ||.|.       |.|:|.|:                    .::||
 Frog   222 --------------------DCWSIGVITYILLCGYPPFY--------------------EETES 246

Human   613 EILRLLQPGPSEHSKSF----DKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLK---FIRNLG 670
            .:...::.|..|....|    .|.......|:::|.:|   ||.|..:     .||   ...|..
 Frog   247 RLFEKIREGAYEFESPFWDDISKSAKDFISCLLEKDSK---KRYNCEK-----ALKHPWIAGNTA 303

Human   671 EHIDEEKHKKMKLKIGDPSLYFQKTF-PDLVIYVYTKL--QNTEYRKHFP-----QTHSPNKP 725
            .|.|..:...:::|.......:::.| ...|:|...||  .|::...:.|     ....||.|
 Frog   304 LHRDIYRSVSIQIKKNFAKSKWKQAFNAATVVYHMKKLHMNNSQTSANVPTIKVSDATRPNTP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNASELNP_066956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ANK repeat 24..56 CDD:293786
ANK 1 24..53
Ank_2 29..122 CDD:289560
ANK 2 58..87
ANK 59..188 CDD:238125
ANK repeat 59..89 CDD:293786
ANK repeat 91..122 CDD:293786
ANK 3 91..120
Ank_2 96..199 CDD:289560
ANK repeat 124..154 CDD:293786
ANK 4 124..153
ANK repeat 167..199 CDD:293786
ANK 5 167..197
Ank_2 172..270 CDD:289560
ANK 196..321 CDD:238125 1/3 (33%)
ANK repeat 201..236 CDD:293786
ANK 6 201..234
2-5A binding (P-loop) 1 229..242
ANK 7 238..268
Ank_2 243..326 CDD:289560 3/8 (38%)
2-5A binding (P-loop) 2 253..275
ANK repeat 272..326 CDD:293786 3/8 (38%)
ANK 8 272..301
ANK 9 303..329 5/11 (45%)
PKc_like 375..587 CDD:304357 55/237 (23%)
Pkinase 387..586 CDD:278497 53/224 (24%)
RNase_RNase-L 590..708 CDD:199218 23/127 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..741 4/16 (25%)
camk1gXP_004910791.1 STKc_CaMKI_gamma 40..324 CDD:271068 78/376 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.