DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Birc2 and Bruce

DIOPT Version :9

Sequence 1:NP_068520.2 Gene:Birc2 / 60371 RGDID:620690 Length:589 Species:Rattus norvegicus
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:175 Identity:53/175 - (30%)
Similarity:73/175 - (41%) Gaps:30/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat   125 IHSSLPSNPLNSRAVEDFSLRM-NPCSYAMSTEEARFLSYSMWP---LSFLSPAELAKAGFYY-- 183
            |:..|....:.|| |.||.... |.....|.:|..|..::..||   ..:..|.::|:||||:  
  Fly   217 INERLTDMMMGSR-VPDFGWNFSNFQRVLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQP 280

  Rat   184 -TGPGDRVACFACGGKLSNWEPNDDPLSEHRRHFPHCPFLENTSETQRFSVSNLSMQTHSARMRT 247
             :...||..||.|...|..||..|:|.|||.||.|.|||::. ..||...:|             
  Fly   281 SSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSPLCPFVKG-EYTQNVPLS------------- 331

  Rat   248 FLYWPSSVLVQPEQLASAGFYYVDHND--DVKCFCCD--GGLRCW 288
            ..|..:..|..|    ..||..:.::|  :|.|..|.  |.|..|
  Fly   332 ITYATNPALPAP----GLGFDIISNSDYANVLCTSCSQTGELSVW 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Birc2NP_068520.2 BIR 24..93 CDD:197595
BIR 155..224 CDD:197595 29/74 (39%)
BIR 240..308 CDD:197595 12/53 (23%)
UBA_BIRC2_3 362..408 CDD:270577
CARD_BIRC2_BIRC3 425..514 CDD:260038
zf-C3HC4_3 538..583 CDD:290631
BruceNP_001262460.1 BIR 251..321 CDD:279047 28/69 (41%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.