DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIT1 and Rala

DIOPT Version :9

Sequence 1:NP_001243750.1 Gene:RIT1 / 6016 HGNCID:10023 Length:236 Species:Homo sapiens
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:187 Identity:82/187 - (43%)
Similarity:124/187 - (66%) Gaps:1/187 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    39 YKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMR 103
            :|::|:|:|||||||:|:||:...|.||::||..|:|:.::.:|.|...:||||||||.::.|:|
  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76

Human   104 DQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLA 168
            |.|.|:||||:..:||||..||...:||::.|.||:..:..|.:|||||.||...|:|...|...
  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141

Human   169 LAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLK 225
            .|::::.|:.||||..|..:|.||..|:||||.::.|...|...::|.:... :|||
  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKK-RRLK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIT1NP_001243750.1 Rit_Rin_Ric 37..208 CDD:206712 77/168 (46%)
small_GTPase 37..202 CDD:197466 76/162 (47%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 75/161 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.