DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIT1 and Rheb

DIOPT Version :10

Sequence 1:NP_001243750.1 Gene:RIT1 / 6016 HGNCID:10023 Length:236 Species:Homo sapiens
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:161 Identity:60/161 - (37%)
Similarity:93/161 - (57%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    36 SREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFT 100
            ::|..:.|:|...||||::.:||:..:|.:.:|||||:.:....|:..:...:.::|||||.|::
  Fly     3 TKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYS 67

Human   101 AMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEE 165
            ....||.....|:::.||||.::||..|:...:.:..|......||||||||.||.|.|.|:.||
  Fly    68 IFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEE 132

Human   166 GLALAREFSCPFFETSAAYRYYIDDVFHALV 196
            |..||..:...|.||||.....:.|:||.|:
  Fly   133 GKKLAESWRAAFLETSAKQNESVGDIFHQLL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIT1NP_001243750.1 Rit_Rin_Ric 37..208 CDD:206712 60/160 (38%)
RhebNP_730950.2 RheB 5..182 CDD:206709 60/159 (38%)

Return to query results.
Submit another query.