DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIT2 and Rala

DIOPT Version :9

Sequence 1:NP_002921.1 Gene:RIT2 / 6014 HGNCID:10017 Length:217 Species:Homo sapiens
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:202 Identity:84/202 - (41%)
Similarity:123/202 - (60%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    15 SGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA 79
            :.|...:||:|:|:|||||||:|:||:..:|.:.::||..|:|:.:|.:|.|...:||||||||.
  Fly     6 TAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQE 70

Human    80 EFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVS 144
            ::.|:|:.|.|.||||:..:|:||.:|||...:|:|.|.:|::...||.:|||||.||...|:|.
  Fly    71 DYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVP 135

Human   145 TEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSL 209
            ..|....||::...:.||||..|..:|..|..|:||||.:           |.:||  |...|..
  Fly   136 LSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSR-----------KTEDS--KATSGRA 187

Human   210 K---KKR 213
            |   |||
  Fly   188 KDRCKKR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIT2NP_002921.1 Rit_Rin_Ric 19..190 CDD:206712 74/170 (44%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 73/161 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.