DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RGS13 and Axn

DIOPT Version :9

Sequence 1:NP_002918.1 Gene:RGS13 / 6003 HGNCID:9995 Length:159 Species:Homo sapiens
Sequence 2:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster


Alignment Length:149 Identity:35/149 - (23%)
Similarity:68/149 - (45%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    14 DESKR-PPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHS--DENIQFWMACETYKKIAS 75
            |.||. .||      .|.||::..:|:..:.|..::..|::.|..  ::::.|:.|||..|:...
  Fly    39 DTSKNSSPS------YLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTD 97

Human    76 RWSRISRAKKLYKIYIQPQSPREINIDSSTR---ETIIRNIQEP-TETCFEEAQKIVYMHMERDS 136
            .    .:.|::.....:.....:::|....|   :.|..|.:.| :...|:..|:.|.:.:..:.
  Fly    98 P----EKIKQIIGAIYRFLRKSQLSISDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNI 158

Human   137 YPRFLKSEMYQKLLKTMQS 155
            ||.||.||||...::.|.:
  Fly   159 YPTFLCSEMYILYIQQMSA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RGS13NP_002918.1 RGS_RGS13 35..148 CDD:188671 26/118 (22%)
AxnNP_733336.1 RGS 55..170 CDD:295367 26/118 (22%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.