DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RGS1 and Axn

DIOPT Version :9

Sequence 1:NP_002913.3 Gene:RGS1 / 5996 HGNCID:9991 Length:209 Species:Homo sapiens
Sequence 2:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster


Alignment Length:166 Identity:43/166 - (25%)
Similarity:80/166 - (48%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    55 RSMIPHLESGMK------SSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFS--EEN 111
            |..:|..||.:|      :..||:  |:...:.|:::|..||.::.|..:|..:::.|..  .::
  Fly    20 RPPVPGEESRVKKMTEGVADTSKN--SSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDH 82

Human   112 IEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINI--DFRTRESTAKKIKAP-----TPT 169
            :.|:.|||..|: ::|  |.|.::|..|........|::|  |.|.:   .|.||..     :|.
  Fly    83 LNFYFACEGLKQ-QTD--PEKIKQIIGAIYRFLRKSQLSISDDLRAQ---IKAIKTNPEIPLSPH 141

Human   170 CFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA 205
            .||..|:.:...:..:.||.||.|::|:..:..:.|
  Fly   142 IFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RGS1NP_002913.3 RGS_RGS1 86..199 CDD:188670 33/121 (27%)
AxnNP_733336.1 RGS 55..170 CDD:295367 33/120 (28%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.