DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RET and drpr

DIOPT Version :9

Sequence 1:NP_066124.1 Gene:RET / 5979 HGNCID:9967 Length:1114 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:398 Identity:82/398 - (20%)
Similarity:122/398 - (30%) Gaps:139/398 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   286 KRKEDTVVATLRVFDADVVPASGELVRRYT---STLLPGDTWAQ------QTFRVEH-WPNETSV 340
            ||:|        :::.|||         ||   |....|.||..      .|:|::| ..|:|..
  Fly    30 KRRE--------LYNVDVV---------YTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKT 77

Human   341 QANGSFVRATVHDY-----RLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPV 400
            .|....||.....|     ..|.:.:......|.:.......|..:.||...:     |..    
  Fly    78 IAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDI-----NCP---- 133

Human   401 SLHLPSTYSLSVSRRARRFAQIGKVCVEN--CQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSG 463
                |..|..:.|.:..        |:.|  |:.||| :.:.....:||.|:.:       ...|
  Fly   134 ----PGWYGRNCSMQCD--------CLNNAVCEPFSG-DCECAKGYTGARCADI-------CPEG 178

Human   464 ILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLEC 528
            ....|.::..|.....:.|::          ..:.|......|..      |.:.|...|...:|
  Fly   179 FFGANCSEKCRCENGGKCHHV----------SGECQCAPGFTGPL------CDMRCPDGKHGAQC 227

Human   529 EE---CGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDI--NICPQDCLRG 588
            ::   |             |.|||        |.|.|..|   .|:...|.|:  |.||      
  Fly   228 QQDCPC-------------QNDGK--------CQPETGAC---MCNPGWTGDVCANKCP------ 262

Human   589 SIVGGHEPGEP------RGIKAGY--GTCNCFP--EEEKCFCE-------------PEDIQDPLC 630
              ||.:.||..      :|....:  |.|.|.|  ..|:||.|             .:...|.:|
  Fly   263 --VGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMC 325

Human   631 DELCRTVI 638
            |....|.|
  Fly   326 DRANGTCI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RETNP_066124.1 Cadherin 172..261 CDD:278457
PTKc_RET 723..1012 CDD:173631
Pkinase_Tyr 724..1005 CDD:285015
Inhibitors binding 805..807
drprNP_001261276.1 EMI 27..92 CDD:284877 20/78 (26%)
EGF_CA 274..319 CDD:304395 9/44 (20%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.