DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RET and kin-30

DIOPT Version :9

Sequence 1:NP_066124.1 Gene:RET / 5979 HGNCID:9967 Length:1114 Species:Homo sapiens
Sequence 2:NP_506771.3 Gene:kin-30 / 180032 WormBaseID:WBGene00002211 Length:458 Species:Caenorhabditis elegans


Alignment Length:444 Identity:130/444 - (29%)
Similarity:206/444 - (46%) Gaps:54/444 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   612 FPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCYHKFAHKPPISSAEMTF 676
            ||.....|....:..|.  .|....:|...:...||..||...|...|:.:..::   |||....
 Worm     5 FPNRFARFVRSVENHDE--SEKPNLIIVFLMCALFIYGVLSIIFVTICFLRRIYR---SSATKNG 64

Human   677 RR---------PAQAFPVSYSSSGARRPSLDSM----ENQVSVDAFKILE-------DPKWEFPR 721
            .|         .||....|.||....:..::::    |..:..|...:.|       :|.:|...
 Worm    65 NRRYLVQNTYVKAQLDTNSSSSLPVDKEIIETISINEETPIITDYQPLNERAEYLPYNPAFEIHS 129

Human   722 KNL-VLGKTLGEGEFGKVVKATAFHLKGRAGYTT---VAVKMLKENASPSELRDLLSEFNVLKQV 782
            ::| |..|..|:|.||||.||....:..:.|...   ||||...::...|:.:.:|.|..::..:
 Worm   130 EHLDVFEKQFGQGNFGKVNKALLKLINQKTGEVVRMDVAVKKPADSTDKSQDKLILDEIKLMCAI 194

Human   783 -NHPHVIKLYGACSQDGPL------LLIVEYAKYGSLRGFLRESRKVGPGYLGS----GGSR-NS 835
             .||:|:.:.||.::...:      |::.|:.:.|.||..|:.:.......|.|    ||.. ||
 Worm   195 GKHPNVLAIVGAITKQEKVIGREHNLVVTEFVEGGDLRSVLKYTPYTFHDELTSTDRTGGQMVNS 259

Human   836 SSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY 900
            ...|.     |:..||.|||:||:.||:|||....||||||.||:.|...:.::|.||||:|. :
 Worm   260 DIFDE-----LSTSDLYSFAYQIANGMEYLAAKPCVHRDLALRNVFVKRNKMIRIGDFGLARH-H 318

Human   901 EEDSYVK---RSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGI---PPER 959
            .:.||.:   .....:|:.|:|.|...:..:|..:||||:||.|:|:.:||.:||..:   |...
 Worm   319 SKKSYYRMQCNPDTPLPIFWLAPECFNESKFTEMTDVWSYGVCLFELFSLGESPYKKLHNSPSYD 383

Human   960 LFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR 1013
            :.:.||.|:|:..|..|:.|:|..||.||..:...||.|.: .||..|.::.|:
 Worm   384 VVHYLKKGYRLSAPRYCNAEIYEFMLYCWNIDATLRPKFTE-CKDFCKSLITRK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RETNP_066124.1 Cadherin 172..261 CDD:278457
PTKc_RET 723..1012 CDD:173631 103/310 (33%)
Pkinase_Tyr 724..1005 CDD:285015 101/302 (33%)
Inhibitors binding 805..807 1/1 (100%)
kin-30NP_506771.3 TyrKc 134..428 CDD:197581 100/300 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.