DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPF2 and SFP1

DIOPT Version :9

Sequence 1:XP_024304405.1 Gene:DPF2 / 5977 HGNCID:9964 Length:575 Species:Homo sapiens
Sequence 2:NP_013507.1 Gene:SFP1 / 851119 SGDID:S000004395 Length:683 Species:Saccharomyces cerevisiae


Alignment Length:314 Identity:63/314 - (20%)
Similarity:85/314 - (27%) Gaps:156/314 - (49%)


- Green bases have known domain annotations that are detailed below.


Human   138 VDDDSLGEF----------PVTNS------------RARKRILEPDDF-----LDDLDDEDYEED 175
            :|||.||..          |.|.|            ::.:.::|..|.     .||:||:|.::|
Yeast   488 MDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDDDDDVDDDDDDDD 552

Human   176 TPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDSECLTSGWVDLALDPAPALDMRGGRVVF 240
            .........|.||.|.:...|:.                  ...::|   |||        |.::
Yeast   553 DDDTENGSSSNGKSVHNNNYKMP------------------QQAYID---DPA--------RRLY 588

Human   241 LPRVLKQTWALVLPADCFRLRPLGGLGPCYMTGGTCMLWERFLPSSGVGLLVGATAGRVGLSTDG 305
            :....:|.     |..|    |:.|....|....              ||......|...     
Yeast   589 VMDHEEQK-----PFKC----PVIGCEKTYKNQN--------------GLKYHRLHGHQN----- 625

Human   306 LQVSWPQLSQGPRGLTLSFSTSVLFFFLSALPHFCPSTLGAPSPLGFLSRLLCFPAAAAPVSSVS 370
                 .:|.:.|.|                                              ..||.
Yeast   626 -----QKLHENPDG----------------------------------------------TFSVI 639

Human   371 RPSSHDFSFCLSDSF-------KQKHTSKAPQR--VCGKRYKNRPGLSYHYAHS 415
            .|.|       :|||       |.|     |.|  ||||||||..||.||..||
Yeast   640 DPDS-------TDSFGDGMGSAKDK-----PYRCEVCGKRYKNLNGLKYHRGHS 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPF2XP_024304405.1 Requiem_N 13..79 CDD:316564
SFP1 <397..417 CDD:227516 14/19 (74%)
PHD1_DPF2_like 456..511 CDD:277161
PHD2_d4 513..558 CDD:277005
SFP1NP_013507.1 SFP1 43..683 CDD:227516 63/314 (20%)
C2H2 Zn finger 600..629 CDD:275368 7/56 (13%)
C2H2 Zn finger 661..683 CDD:275368 14/21 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.