DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REN and CG6508

DIOPT Version :10

Sequence 1:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens
Sequence 2:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster


Alignment Length:41 Identity:12/41 - (29%)
Similarity:18/41 - (43%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   404 PDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGNGGAG 444
            |::...|..||||...:.....||.....|.:|::.|...|
  Fly    63 PEITIRGSNYDPSGVNMLLSKVLLVTKLLLIAALMSNYDIG 103

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RENNP_000528.1 A1_Propeptide 33..>51 CDD:462326