DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REN and CG6508

DIOPT Version :9

Sequence 1:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens
Sequence 2:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster


Alignment Length:345 Identity:127/345 - (36%)
Similarity:191/345 - (55%) Gaps:30/345 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    71 NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDS 135
            ::.::.:|.|..:.:|...:.||||||.|.:.||||||::||||.|||....||..|..:::|.|
  Fly    59 SSQTTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSAS 123

Human   136 SSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITV-TQMFGEVTEMPALPFMLAEFDGVVGMGFI 199
            ||:..:|...:::|.:|::|||||.|.:.:.|:.: .|.|.|..:.|...|:...|||::||.|.
  Fly   124 SSHVEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFA 188

Human   200 EQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKT 264
            ..:.|..|| |||||.||::|..|||.|..||. .||| ||:::.||.|...|.|..:|:.:...
  Fly   189 SISGGVTTP-FDNIIRQGLVKHPVFSVYLRRDG-TSQS-GGEVIWGGIDRSIYRGCINYVPVSMP 250

Human   265 GVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYIS---GSTSSIEKLMEALGAKKRLFDYVVKCN 326
            ..||.....|.: ...||| :||.|:.|||.|.|:   .:..:|.|::.|..|...  :..|.|:
  Fly   251 AYWQFTANSVKI-EGILLC-NGCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDG--EAFVDCS 311

Human   327 EGPTLPDISFHLGGKEYTLTSADYVFQ-ESYSSKKLCTLAIHAMDIPPPTGPT-------WALGA 383
            ....||:::.::||..||||..||::: ::.:::.||.           :|.|       |.||.
  Fly   312 SLCRLPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCL-----------SGFTYLQGNLLWILGD 365

Human   384 TFIRKFYTEFDRRNNRIGFA 403
            .|:.|.||.||....|||||
  Fly   366 IFLGKVYTVFDVGKERIGFA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RENNP_000528.1 A1_Propeptide 33..>51 CDD:311771
renin_like 78..405 CDD:133154 127/338 (38%)
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 126/336 (38%)
Asp 73..387 CDD:278455 125/331 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.