DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL2A1 and Debcl

DIOPT Version :9

Sequence 1:NP_004040.1 Gene:BCL2A1 / 597 HGNCID:991 Length:175 Species:Homo sapiens
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:165 Identity:45/165 - (27%)
Similarity:69/165 - (41%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     7 GYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNV---AFSVQKEVEKNLKSCLDNVN-------- 60
            |.:.|.....|:.:|   .|||     |.|:..|   ..|:.:|:|:.......|::        
  Fly   117 GVLNRKVTQRLRNIL---DPGS-----SHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPF 173

Human    61 --VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVA 123
              :...|.|..|.|.|.:..|... |.||:|::|||..|......:||   ...|..:.:...:|
  Fly   174 GELEDSDMAPMLLNLVAKDLFRSS-ITWGKIISIFAVCGGFAIDCVRQ---GHFDYLQCLIDGLA 234

Human   124 EFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFL 158
            |.|.::...|:..|||| .|..:...|:.|..|||
  Fly   235 EIIEDDLVYWLIDNGGW-LGLSRHIRPRVGEFTFL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL2A1NP_004040.1 Bcl-2_like 10..146 CDD:132900 39/148 (26%)
BH1 77..97 8/19 (42%)
BH2 132..147 6/14 (43%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 40/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.