DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG1B and CG7763

DIOPT Version :9

Sequence 1:NP_006498.1 Gene:REG1B / 5968 HGNCID:9952 Length:166 Species:Homo sapiens
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:132 Identity:34/132 - (25%)
Similarity:47/132 - (35%) Gaps:36/132 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    48 YYFNEDPE--TWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWI-GLHDPKKNR 109
            ||:.|..|  .|.||...|..|             |..:|||..:...|..|..: ||     ||
  Fly   116 YYYIEKEEKLNWHDALDKCHKM-------------GGHLASLQSQEELDRFNNQLNGL-----NR 162

Human   110 RW-------------HWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFV 161
            .|             ..:.||..::.||..|.|:  ..|.|..:.:.:|.....|.||.....|:
  Fly   163 YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPT--KDGECVDIRTFNGKTTMNDNSCFANLYFI 225

Human   162 CK 163
            |:
  Fly   226 CE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REG1BNP_006498.1 CLECT 36..164 CDD:413318 34/132 (26%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.