DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG1A and lectin-22C

DIOPT Version :9

Sequence 1:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:119 Identity:32/119 - (26%)
Similarity:57/119 - (47%) Gaps:12/119 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    48 YYFNE--DRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHD-PKKNR 109
            ||:.|  ..:.|..|...|:|| .|:|..:..:|:.|.:.:.:||    |.:.|:|::| ..:.:
  Fly   146 YYYIEKVSEKNWSTASKTCRNM-GGHLADIKDEADLAAIKANLKE----DTHYWLGINDLDHEGK 205

Human   110 RWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCK 163
            .....:|...::..|..|.||.::...||.|.:...:    |.||...|.|:|:
  Fly   206 FLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMY----DYPCHYTFRFICQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REG1ANP_002900.2 CLECT 36..164 CDD:321932 32/119 (27%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.