DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRPH2 and Tsp86D

DIOPT Version :9

Sequence 1:NP_000313.2 Gene:PRPH2 / 5961 HGNCID:9942 Length:346 Species:Homo sapiens
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:306 Identity:75/306 - (24%)
Similarity:129/306 - (42%) Gaps:78/306 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    20 LWLMNWFSVLAGIIIFSLGLFLKIE--------LRKRS--DVMNNSESHFVPNSLIGMGVLSCVF 74
            ::|:|:...|.|.::.::|::..::        ||..:  ||:.|     :...:|..||:  ||
  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFN-----ISLVMIIAGVI--VF 92

Human    75 N-SLAGKICYDALDPAKYARWKPWLKPYLAIC-VLFNIILFLVALCCFLLRGSLENTLGQGLKNG 137
            . |.||  |..||      |...||....::| :||.|:...:|:.||:        ..|.:.:.
  Fly    93 TVSFAG--CLGAL------RENTWLLKLYSMCLLLFFILEMSLAIICFV--------FPQYMNSF 141

Human   138 MKY---------YRDTDTPGRCFMKKTIDMLQIEFKCCG--NNGFRDWFEIQWISNRYLDFSSKE 191
            ::|         |||...     ::..||..|.||.|||  |.|::||.:     |.|.:.||..
  Fly   142 LEYQFTDKIIHSYRDDSD-----LQNFIDFAQQEFNCCGLSNAGYQDWSK-----NEYFNCSSPS 196

Human   192 VKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQT---EELNLWVRGCRAA 253
            | :|.           |||:|||..::.   |...:.|....|....::   ....:|..||...
  Fly   197 V-ERC-----------GVPYSCCINATD---ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEI 246

Human   254 LLSYYSSLMNSMGVVTLLIWLFEVTITIGLRYLQTSLDGVSNPEES 299
            :..:....:..:..|.|.|.|.::.:.    ||..:|:|..:.::|
  Fly   247 VRVWVERNLYVIAGVALGIALLQLFVI----YLAKTLEGQIDLQKS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRPH2NP_000313.2 Tetraspannin 20..277 CDD:278750 70/282 (25%)
peripherin_like_LEL 120..262 CDD:239415 36/155 (23%)
Interaction with MREG. /evidence=ECO:0000250 341..346
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 70/283 (25%)
penumbra_like_LEL 132..255 CDD:239411 36/155 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.