DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RCVRN and CG2256

DIOPT Version :10

Sequence 1:NP_002894.1 Gene:RCVRN / 5957 HGNCID:9937 Length:200 Species:Homo sapiens
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:207 Identity:43/207 - (20%)
Similarity:91/207 - (43%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     6 SGALSKEILEELQLNTKFSEEE---LCSWYQSFLKDCPTGR---------------------ITQ 46
            ||.::.::|:.|:..|:|:::|   ||..|:..:.:|....                     |.:
  Fly   105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169

Human    47 QQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDG-TLDFKEYVIALHMTTAGKTNQKLEWAFSLYD 110
            ..|:.:....|.....:...:.:|.|:|...:| .|..:.::|.|.....|...::..:.|.:||
  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234

Human   111 VDGNGTISKNEVLEIVM-AIFKMITPEDVKLLPDDENTPE---KRAEKIWKYFGKNDDDKLTEKE 171
            ::.:|.|:|:|:..::. .:.|.         |.||:..|   ...|.:.|.|..:.|.|::.::
  Fly   235 LNTDGFITKDEMFTLLRNCLIKQ---------PQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLED 290

Human   172 FIEGTLANKEIL 183
            |: ||:..:.:|
  Fly   291 FM-GTVTAEPLL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RCVRNNP_002894.1 FRQ1 42..175 CDD:444056 29/158 (18%)
EFh 65..127 CDD:238008 15/62 (24%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192
CG2256NP_572437.2 PRK12309 <103..290 CDD:183426 39/193 (20%)
EF-hand_7 224..292 CDD:463900 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.