DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RCN2 and CG31650

DIOPT Version :9

Sequence 1:NP_001258766.1 Gene:RCN2 / 5955 HGNCID:9935 Length:335 Species:Homo sapiens
Sequence 2:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster


Alignment Length:363 Identity:117/363 - (32%)
Similarity:185/363 - (50%) Gaps:54/363 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     5 PRTAALGLLLLCA--------------AAAGAGKAEE----------LHYPL--------GERRS 37
            ||...|..|.|||              |.|.:.|.|:          ::.|.        ||...
  Fly     2 PRNLPLLPLTLCAVALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGEDGEHNV 66

Human    38 DYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEA 102
            ::|.||::|..::..|:..|..:|.::||..:||.:||:.|.|:...||.:||..|||..:.:||
  Fly    67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEA 131

Human   103 KQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALDDAEEESFRKEFAICKKQSFCFWLLRFN 167
            ..:|.|.|:::|:.:||.||   :.|.....||:...:..:.:|:..|..:.|            
  Fly   132 ADRFEEIDQDADERITWKEY---LQDTYAMEDEDFKKETIDYDSYEDEQKMIK------------ 181

Human   168 LHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGD 232
               :||:.|..|:.:....|:||||:.|::|||...|...:::..:::.|.:.||.::.:||:| 
  Fly   182 ---QDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG- 242

Human   233 YRWDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNG 297
               |..::.|.||::.||:||..|:|.:.||.|...|:|.|:||:|..||.:|..||....|.:.
  Fly   243 ---DAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDH 304

Human   298 DKKLSEEEILENPDLFLTSEATDYGRQLHDDYFYHDEL 335
            |.:||..|||.|.|.|:.|||||||..|.:.....|||
  Fly   305 DDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RCN2NP_001258766.1 EFh_CREC_RCN2 29..314 CDD:320022 94/292 (32%)
EF-hand motif 29..59 CDD:320022 9/37 (24%)
EF-hand motif 65..94 CDD:320022 12/28 (43%)
EF-hand motif 101..130 CDD:320022 11/28 (39%)
EF-hand motif 171..200 CDD:320022 11/28 (39%)
EF-hand motif 208..237 CDD:320022 6/28 (21%)
EF-hand motif 249..278 CDD:320022 14/28 (50%)
EF-hand motif 285..314 CDD:320022 12/28 (43%)
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 22/55 (40%)
EFh 100..153 CDD:298682 22/55 (40%)
EF-hand_7 184..241 CDD:290234 17/56 (30%)
EFh 184..241 CDD:298682 17/56 (30%)
EFh 228..281 CDD:298682 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147156
Domainoid 1 1.000 58 1.000 Domainoid score I10839
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2176
Inparanoid 1 1.050 199 1.000 Inparanoid score I3792
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46113
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 1 1.000 - - oto88494
orthoMCL 1 0.900 - - OOG6_108120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8362
SonicParanoid 1 1.000 - - X5175
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.