DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RCN1 and myd

DIOPT Version :10

Sequence 1:NP_002892.1 Gene:RCN1 / 5954 HGNCID:9934 Length:331 Species:Homo sapiens
Sequence 2:NP_732406.1 Gene:myd / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:119/260 - (45%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    81 KERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDR----DKDDKISWEEYK 141
            |:.|.|...|.|...||.::.:||..:|.|....:|.:.:....:::.|    ..|..|:|:|| 
  Fly   157 KQILAKAFKRADRSRDGILSIQELGQYINRRIVEHIDEAIMNNAREFRRVDIGPADGLITWDEY- 220

Human   142 QATYGYYLGN------PAEFHDSSDHHTFKKM----LPRDERRFKAADLNGDLTATREEFTAFLH 196
               :.::|..      ..:.||...|....:.    :.||:.|:..|......|.|.:|:.:|.|
  Fly   221 ---HRFFLREHGMTEADIDEHDEIRHTALNRRAREDMMRDKARWSEAARTDLFTLTIDEYLSFRH 282

Human   197 PE-EFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPD---------WVLSEREQ 251
            || ...::.|:|. :.|...|::||     |:...:.||......:.|         .::..||:
  Fly   283 PESSVSNLLELVD-DLLRQFDQDGD-----DQLTLEEFSDLNVDDDDDLMRKSLISKTLVERREE 341

Human   252 FNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQ 316
            |....|.|.|||.|:.|:.:::.|:...:|..||..|....|:||||.||.:|:.::..:|:.|:
  Fly   342 FKRIIDKNHDGKADRGELLNYVNPKTPRYALQEAATLFSLCDENKDELLTLKEMTDHAEIFLQSK 406

Human   317  316
              Fly   407  406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RCN1NP_002892.1 EFh_CREC_RCN1 48..314 CDD:320027 67/256 (26%)
EF-hand motif 48..77 CDD:320027
EF-hand motif 83..112 CDD:320027 10/28 (36%)
EF-hand motif 119..148 CDD:320027 6/32 (19%)
EF-hand motif 170..199 CDD:320027 11/29 (38%)
EF-hand motif 207..236 CDD:320027 8/28 (29%)
EF-hand motif 248..277 CDD:320027 11/28 (39%)
EF-hand motif 284..314 CDD:320027 12/29 (41%)
Prevents secretion from ER 328..331
mydNP_732406.1 EFh_CREC 160..403 CDD:330175 65/252 (26%)
EF-hand motif 160..188 CDD:320023 10/27 (37%)
EF-hand motif 198..228 CDD:320023 7/33 (21%)
EF-hand motif 256..285 CDD:320023 10/28 (36%)
EF-hand motif 293..322 CDD:320023 8/34 (24%)
EF-hand motif 338..367 CDD:320023 11/28 (39%)
EF-hand motif 374..403 CDD:320023 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.