| Sequence 1: | NP_005049.1 | Gene: | RBMY1A1 / 5940 | HGNCID: | 9912 | Length: | 496 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188585.1 | Gene: | Rbp1-like / 32293 | FlyBaseID: | FBgn0030479 | Length: | 247 | Species: | Drosophila melanogaster |
| Alignment Length: | 213 | Identity: | 51/213 - (23%) |
|---|---|---|---|
| Similarity: | 82/213 - (38%) | Gaps: | 43/213 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Human 3 EADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKD 67
Human 68 MNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSHEGHLDD 132
Human 133 GGYTPDLKMSYSRG----------------LIPVKR----------GPSSRSGGPP------PKK 165
Human 166 SAPSAVARSNSWMGSQGP 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RBMY1A1 | NP_005049.1 | RRM | <1..189 | CDD:223796 | 51/213 (24%) |
| RRM_RBMX_like | 7..85 | CDD:240828 | 22/77 (29%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 78..349 | 30/138 (22%) | |||
| RBM1CTR | 174..218 | CDD:285341 | 2/10 (20%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 452..496 | ||||
| Rbp1-like | NP_001188585.1 | RRM | <11..>81 | CDD:223796 | 22/80 (28%) |
| RRM_SRSF3_like | 12..81 | CDD:240819 | 22/79 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23147 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||