powered by:
Protein Alignment RBMY1A1 and exc-7
DIOPT Version :9
Sequence 1: | NP_005049.1 |
Gene: | RBMY1A1 / 5940 |
HGNCID: | 9912 |
Length: | 496 |
Species: | Homo sapiens |
Sequence 2: | NP_496057.1 |
Gene: | exc-7 / 174506 |
WormBaseID: | WBGene00001368 |
Length: | 456 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 24/71 - (33%) |
Similarity: | 45/71 - (63%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLH 74
||:..|:.:|::.:|..:|.:.|.|..|.:::|.|.:.:|:||::..|..:|.||...:||.:|.
Worm 376 LFVYNLSSDTDDTLLWQLFSQFGAIVNVKILRDLTQQCKGYAFVSMSNYTEAYNAMLSLNGTNLA 440
Human 75 GKAIKV 80
||.::|
Worm 441 GKTLQV 446
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.