DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBMY1A1 and exc-7

DIOPT Version :9

Sequence 1:	NP_005049.1	Gene:	RBMY1A1 / 5940	HGNCID:	9912	Length:	496	Species:	Homo sapiens
Sequence 2:	NP_496057.1	Gene:	exc-7 / 174506	WormBaseID:	WBGene00001368	Length:	456	Species:	Caenorhabditis elegans

Alignment Length:	71	Identity:	24/71 - (33%)
Similarity:	45/71 - (63%)	Gaps:	0/71 - (0%)

- Green bases have known domain annotations that are detailed below.

Human    10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLH 74
            ||:..|:.:|::.:|..:|.:.|.|..|.:::|.|.:.:|:||::..|..:|.||...:||.:|.
Worm   376 LFVYNLSSDTDDTLLWQLFSQFGAIVNVKILRDLTQQCKGYAFVSMSNYTEAYNAMLSLNGTNLA 440

Human    75 GKAIKV 80
            ||.::|
Worm   441 GKTLQV 446

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBMY1A1	NP_005049.1	RRM	<1..189	CDD:223796	24/71 (34%)
		RRM_RBMX_like	7..85	CDD:240828	24/71 (34%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	78..349		1/3 (33%)
		RBM1CTR	174..218	CDD:285341
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	452..496
exc-7	NP_496057.1	ELAV_HUD_SF	39..455	CDD:273741	24/71 (34%)
		RRM1_Hu	41..118	CDD:241094
		RRM2_Hu	128..206	CDD:241096
		RRM3_Hu	373..449	CDD:240823	24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910