DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBMS1 and PAB1

DIOPT Version :9

Sequence 1:XP_005246794.1 Gene:RBMS1 / 5937 HGNCID:9907 Length:422 Species:Homo sapiens
Sequence 2:NP_011092.1 Gene:PAB1 / 856912 SGDID:S000000967 Length:577 Species:Saccharomyces cerevisiae


Alignment Length:404 Identity:85/404 - (21%)
Similarity:143/404 - (35%) Gaps:147/404 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    62 TNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTN-KCKGYGFVDFDSPAAAQKAVSALKA 125
            ||||::.:...|||:...:|...:|.|||  |.|:|..: |.||:|||:::....|.|||.||..
Yeast   219 TNLYVKNINSETTDEQFQELFAKFGPIVS--ASLEKDADGKLKGFGFVNYEKHEDAVKAVEALND 281

Human   126 SGVQAQ----------------------------MAKQQEQDPTNLYISNLPLSMDEQELENMLK 162
            |.:..:                            |||.|   ..||::.||..|:|:::||....
Yeast   282 SELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQ---GVNLFVKNLDDSVDDEKLEEEFA 343

Human   163 PFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGG 227
            |:|.:.|.:::|..:|.|:|.||....:.|:....|                 ||          
Yeast   344 PYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAI-----------------TE---------- 381

Human   228 QKKRQNPNKYIPNGRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATNRMITQTSITPYI 292
                  .|:.|..|:|.:                             .:||..:.:.::.:    
Yeast   382 ------KNQQIVAGKPLY-----------------------------VAIAQRKDVRRSQL---- 407

Human   293 ASPVSAYQVAKETRENKYRGSAIKVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLA 357
                 |.|:....:....:.:|....:.:.|         ||..:.|.....|..:......|..
Yeast   408 -----AQQIQARNQMRYQQATAAAAAAAAGM---------PGQFMPPMFYGVMPPRGVPFNGPNP 458

Human   358 QQMSHLSLGSTGTYMPATSAMQGAYLPQYAHMQTTAVPVE-------------------EASGQQ 403
            |||:.:. |.....||          ||:.:.....||.:                   :|.|:|
Yeast   459 QQMNPMG-GMPKNGMP----------PQFRNGPVYGVPPQGGFPRNANDNNQFYQQKQRQALGEQ 512

Human   404 ---QVAVETSNDHS 414
               :|:.:|||:.:
Yeast   513 LYKKVSAKTSNEEA 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBMS1XP_005246794.1 RRM1_MSSP1 55..140 CDD:409900 32/106 (30%)
RRM2_MSSP1 141..225 CDD:409903 21/83 (25%)
PAB1NP_011092.1 PABP-1234 38..559 CDD:130689 85/404 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.