DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4 and CG7903

DIOPT Version :9

Sequence 1:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens
Sequence 2:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster


Alignment Length:285 Identity:66/285 - (23%)
Similarity:109/285 - (38%) Gaps:68/285 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    76 TSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR 140
            |:.|:.||:: |.|..:|||..|..||.|:|||::...||||:|..:.|..||..|:.|.|:|:.
  Fly     3 TTAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQP 66

Human   141 MHVQLSTSRL------RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRT 199
            :.|:....:.      |..||.||..|......:|..:.:.|.:.:   .:....:.|:.|.   
  Fly    67 IVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESN---TNFKRNFREEVGG--- 125

Human   200 PYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHL 264
                      .::|            ...||..:.||....|.|  |....|    |.:|     
  Fly   126 ----------RFSN------------EGPRSSNSSAAKFGPVRN--ESNYRQ----QRSA----- 157

Human   265 TSTSLDPYDRHLLPTSGAAATAAA------AAAAAAAVTAASTSYYGRDRSPLRRATAPVP---- 319
                  ||.:.  |.:..::....      |.......:|.:...:|.:|...|..:.|.|    
  Fly   158 ------PYSKG--PPNNESSNQGQGFRNKFAGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGRRN 214

Human   320 ---TVGEGY-GYGHESELSQASAAA 340
               :...|| |.|:.|:....|:::
  Fly   215 FKNSPTSGYRGGGNNSDFQGGSSSS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 27/65 (42%)
PTZ00368 <145..>181 CDD:173561 8/41 (20%)
ZnF_C2HC 161..176 CDD:197667 2/14 (14%)
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364 27/159 (17%)
CG7903NP_651755.2 RRM <4..168 CDD:223796 52/211 (25%)
RRM_SF 6..70 CDD:302621 27/64 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.