DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBM4 and CstF64

DIOPT Version :9

Sequence 1:	NP_002887.2	Gene:	RBM4 / 5936	HGNCID:	9901	Length:	364	Species:	Homo sapiens
Sequence 2:	NP_477453.1	Gene:	CstF64 / 42239	FlyBaseID:	FBgn0027841	Length:	419	Species:	Drosophila melanogaster

Alignment Length:	144	Identity:	38/144 - (26%)
Similarity:	64/144 - (44%)	Gaps:	47/144 - (32%)

- Green bases have known domain annotations that are detailed below.

Human     1 MVKLFIGNLPREATEQEIRSLFEQYGKVLECDII--------KNYGFVHIEDKTAAEDAIRNLHH 57
            |..:|:||:|.||||::::.:|.:.|.||...::        |.:||...:|:..|..|:|||:.
  Fly    15 MRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNG 79

Human    58 YKLHGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEE--YGPVIE------CDIVKDYA 114
            |::.|..:.|:.:                  ||.|. |.:.::  .||.:|      |:
  Fly    80 YEIGGRTLRVDNA------------------CTEKS-RMEMQQLLQGPQVENPYGEPCE------ 119

Human   115 FVHMERAEDAVEAI 128
                  .|||.|.|
  Fly   120 ------PEDAPELI 127

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBM4	NP_002887.2	RRM1_RBM4	2..68	CDD:410018	23/73 (32%)
		RRM2_RBM4	78..144	CDD:410019	13/59 (22%)
		PTZ00368	<145..>181	CDD:173561
		ZnF_C2HC	161..176	CDD:197667
		Interaction with TNPO3. /evidence=ECO:0000269\|PubMed:12628928	196..364
CstF64	NP_477453.1	RRM	<13..>112	CDD:223796	31/115 (27%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	24/73 (33%)
		CSTF2_hinge	112..190	CDD:291025	6/28 (21%)
		CSTF_C	377..416	CDD:291002
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910