Sequence 1: | NP_002887.2 | Gene: | RBM4 / 5936 | HGNCID: | 9901 | Length: | 364 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163280.1 | Gene: | TBPH / 37781 | FlyBaseID: | FBgn0025790 | Length: | 531 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 30/196 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 4 LFIGNLPREATEQEIRSLFEQYGKVLECDI--------IKNYGFVHIEDKTAAEDAIRNLHHYKL 60
Human 61 HGVNINVEASKNKS-KTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDY-AFVHMERAE- 122
Human 123 DAVEAIRGLDNTEFQGKRMHV-------------QLSTSRLRTAPGMG-----DQSGCYRCGKEG 169
Human 170 H 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RBM4 | NP_002887.2 | RRM1_RBM4 | 2..68 | CDD:410018 | 20/71 (28%) |
RRM2_RBM4 | 78..144 | CDD:410019 | 17/80 (21%) | ||
PTZ00368 | <145..>181 | CDD:173561 | 6/31 (19%) | ||
ZnF_C2HC | 161..176 | CDD:197667 | 3/10 (30%) | ||
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 | 196..364 | ||||
TBPH | NP_001163280.1 | RRM1_TDP43 | 108..184 | CDD:240767 | 21/74 (28%) |
RRM2_TDP43 | 192..261 | CDD:240768 | 17/69 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |