DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4 and TBPH

DIOPT Version :9

Sequence 1:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:196 Identity:47/196 - (23%)
Similarity:77/196 - (39%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDI--------IKNYGFVHIEDKTAAEDAIRNLHHYKL 60
            |.:..||.:.||:.:|..||.||:||...|        .|.:|||......|....:.|.|....
  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDG 173

Human    61 HGVNINVEASKNKS-KTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDY-AFVHMERAE- 122
            ....:.|..||... :...|:.||..:....:.:||..|.::|.|.:..|.:.: ||..:...: 
  Fly   174 RWCEVKVPNSK
GMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDP 238

Human   123 DAVEAIRGLDNTEFQGKRMHV-------------QLSTSRLRTAPGMG-----DQSGCYRCGKEG 169
            |..:::.|.|:. .:|..:||             |:.:....:|...|     .|......|:.|
  Fly   239 DVAQSLCGEDHI-IKGVSVHVSNA
APKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNG 302

Human   170 H 170
            |
  Fly   303 H 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018 20/71 (28%)
RRM2_RBM4 78..144 CDD:410019 17/80 (21%)
PTZ00368 <145..>181 CDD:173561 6/31 (19%)
ZnF_C2HC 161..176 CDD:197667 3/10 (30%)
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 21/74 (28%)
RRM2_TDP43 192..261 CDD:240768 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.