DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4 and pAbp

DIOPT Version :9

Sequence 1:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens
Sequence 2:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster


Alignment Length:497 Identity:109/497 - (21%)
Similarity:162/497 - (32%) Gaps:193/497 - (38%)


- Green bases have known domain annotations that are detailed below.


Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDII-------KNYGFVHIEDKTAAEDAIRNLHHYKLH 61
            :||.||.|....:.|...|..:|.:|.|.:.       |.|||||.|.:.||..:|..::...|:
  Fly    92 VFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLN 156

Human    62 GVNINV-------EASK---NKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIV------ 110
            |..:.|       |..|   .|:|..|.::|.|.:....:::|:..||.||.:....::      
  Fly   157 GKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGK 221

Human   111 -KDYAFVHM---ERAEDAVEAIRGLDNTEFQGKRMHV---------------------------- 143
             |.:.||..   |.||.||:|:.|.|..|  ||.::|                            
  Fly   222 SKGFGFVAFETTEAAEAAVQALNGKDMGE--GKSLYVARAQKKAERQQELKRKFEELKQKRHESV 284

Human   144 ------------QLSTSRLR----------TAPGMGDQSG--------CYRCGKEGHWSKECPI- 177
                        .:...|||          :|..|.|:.|        |:....|.    .|.: 
  Fly   285 FGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKGFGFVCFNAASEA----TCAVT 345

Human   178 DRSGRV------------------ADLTEQYNEQYGAVRTPYTMSYGDSLYYNNA---------- 214
            :.:|||                  |.|..||......:|    |.....:|..||          
  Fly   346 ELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMR----MQQLGQIYQPNAASGFFVPTLP 406

Human   215 -----YGALDAYYKR-----------CRAARSYEAVAAAAASVYNYAEQTLSQL----------- 252
                 :|:..|...|           ..|.:..:|.||||......|....:|.           
  Fly   407 SNQRFFGSQVATQMRNTPRWVPQVRPPAAIQGVQAGAAAAGGFQGTAGAVPTQFRSAAAGARGAQ 471

Human   253 PQVQNT----AMASHLTSTSLDPYDRHLLPTSGAAA-----TAA-------AAAAAAAAVTAAST 301
            ||||.|    |.|:::.:|             ||.|     |||       |..|..|....::.
  Fly   472 PQVQGTHAAAAAANNMRNT-------------GARAITGQQTAAPNMQIPGAQIAGGAQQRTSNY 523

Human   302 SYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNS 343
            .|....|:|      |||.:       |:::........:||
  Fly   524 KYTSNMRNP------PVPQL-------HQTQPIPQQLQGKNS 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018 23/77 (30%)
RRM2_RBM4 78..144 CDD:410019 23/115 (20%)
PTZ00368 <145..>181 CDD:173561 10/54 (19%)
ZnF_C2HC 161..176 CDD:197667 3/22 (14%)
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364 42/201 (21%)
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 109/497 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.