DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4 and x16

DIOPT Version :9

Sequence 1:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:201 Identity:50/201 - (24%)
Similarity:85/201 - (42%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    72 NKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKD---YAFVHMERAEDAVEAIRGLDN 133
            ::..:..|::||::.......:|...|..||.:....|.::   :|||..|.|.||.:|:||||.
  Fly     2 SRHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDG 66

Human   134 TEFQGKRMHVQLSTSRLRTAPGMG---------------DQSG-------CYRCGKEGHWSKECP 176
            ....|:|..|:|||.:...:.|.|               |:.|       ||.||..||:::.|.
  Fly    67 RTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCR 131

Human   177 IDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASV 241
             :|..|....:..::......|...|.|...:...:.:.|::..     |:.||.......:||.
  Fly   132 -ERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGR-----RSGRSNGRDENGSASR 190

Human   242 YNYAEQ 247
            |:..|:
  Fly   191 YSDHER 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 22/68 (32%)
PTZ00368 <145..>181 CDD:173561 15/57 (26%)
ZnF_C2HC 161..176 CDD:197667 7/21 (33%)
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364 11/52 (21%)
x16NP_723226.1 RRM <1..>82 CDD:223796 26/79 (33%)
RRM_SRSF3_like 9..81 CDD:240819 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.