Sequence 1: | NP_002887.2 | Gene: | RBM4 / 5936 | HGNCID: | 9901 | Length: | 364 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723226.1 | Gene: | x16 / 33967 | FlyBaseID: | FBgn0028554 | Length: | 258 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 50/201 - (24%) |
---|---|---|---|
Similarity: | 85/201 - (42%) | Gaps: | 31/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 72 NKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKD---YAFVHMERAEDAVEAIRGLDN 133
Human 134 TEFQGKRMHVQLSTSRLRTAPGMG---------------DQSG-------CYRCGKEGHWSKECP 176
Human 177 IDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASV 241
Human 242 YNYAEQ 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RBM4 | NP_002887.2 | RRM1_RBM4 | 2..68 | CDD:410018 | |
RRM2_RBM4 | 78..144 | CDD:410019 | 22/68 (32%) | ||
PTZ00368 | <145..>181 | CDD:173561 | 15/57 (26%) | ||
ZnF_C2HC | 161..176 | CDD:197667 | 7/21 (33%) | ||
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 | 196..364 | 11/52 (21%) | |||
x16 | NP_723226.1 | RRM | <1..>82 | CDD:223796 | 26/79 (33%) |
RRM_SRSF3_like | 9..81 | CDD:240819 | 25/71 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |