DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RBM4 and CG11454

DIOPT Version :9

Sequence 1:	NP_002887.2	Gene:	RBM4 / 5936	HGNCID:	9901	Length:	364	Species:	Homo sapiens
Sequence 2:	NP_608497.1	Gene:	CG11454 / 33175	FlyBaseID:	FBgn0031224	Length:	238	Species:	Drosophila melanogaster

Alignment Length:	105	Identity:	26/105 - (24%)
Similarity:	38/105 - (36%)	Gaps:	24/105 - (22%)

- Green bases have known domain annotations that are detailed below.

Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDI-------IKNYGFVHIEDKTA---AEDAIRNLHHY 58
            ||.|||....||:.:..:|.|.|.:....|       .:|:|||..:...|   |.|..:.|..:
  Fly    72 LFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLELF 136

Human    59 KLHGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKF 98
                          :.|.:.|...|...|......||.:|
  Fly   137 --------------QKKVTIKQQGGKQLPAYNQSRLRNQF 162

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RBM4	NP_002887.2	RRM1_RBM4	2..68	CDD:410018	19/73 (26%)
		RRM2_RBM4	78..144	CDD:410019	6/21 (29%)
		PTZ00368	<145..>181	CDD:173561
		ZnF_C2HC	161..176	CDD:197667
		Interaction with TNPO3. /evidence=ECO:0000269\|PubMed:12628928	196..364
CG11454	NP_608497.1	RRM_RBM7_like	69..143	CDD:240782	20/84 (24%)
CG11454	NP_608497.1	RRM	<70..210	CDD:223796	26/105 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910