DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4 and fne

DIOPT Version :9

Sequence 1:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:171 Identity:38/171 - (22%)
Similarity:71/171 - (41%) Gaps:36/171 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDIIKN--------------------------YGFVHI 42
            |.:..||:..|::|:||||...|::..|.::::                          ||||:.
  Fly    28 LIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNY 92

Human    43 EDKTAAEDAIRNLHHYKLHGVNINVEASKNKSKT--STKLHVGNISPTCTNKELRAKFEEYGPVI 105
            .....||.|:..|:..:|....|.|..::..|::  ...|:|..:....:..:|...|..:|.:|
  Fly    93 VRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKII 157

Human   106 E----CD----IVKDYAFVHMERAEDAVEAIRGLDNTEFQG 138
            .    ||    :.|...|:..::..:|..||:.|:....:|
  Fly   158 TSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018 21/89 (24%)
RRM2_RBM4 78..144 CDD:410019 15/69 (22%)
PTZ00368 <145..>181 CDD:173561
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 38/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.