DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4 and Imp

DIOPT Version :9

Sequence 1:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens
Sequence 2:NP_001245616.1 Gene:Imp / 32009 FlyBaseID:FBgn0285926 Length:638 Species:Drosophila melanogaster


Alignment Length:207 Identity:46/207 - (22%)
Similarity:79/207 - (38%) Gaps:58/207 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    67 VEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIV--KDY--AFVHM--ERAEDAV 125
            :|.:...|.|::|:.:..|......:::....:.||.|.:|:.:  ||.  ..||:  |..|.|.
  Fly    31 LEGAGTSSVTTSKILISGIPMQTRFEDIEPLLKPYGIVKQCEAISSKDQNTQTVHITFENPEQAQ 95

Human   126 EAIRGLDNTEFQGKRMHV-QLSTSRLRT----------APGMGDQS-------------GCYRCG 166
            .|..||:..||:|.::|. ||..::.|:          .||.|.|:             |.. .|
  Fly    96 RAAVGLNGVEFEGSKLHAEQLDKNQRRSQRNQRNPYPGMPGPGRQADFPLRILVQSEMVGAI-IG 159

Human   167 KEGHWSKECPIDRSGRVADLTEQ--------YNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYK 223
            ::|           ..:..:|:|        ..|..|::....|: ||:.....||       .|
  Fly   160 RQG-----------STIRTITQQSRARVDVHRKENVGSLEKSITI-YGNPENCTNA-------CK 205

Human   224 RCRAARSYEAVA 235
            |.......||::
  Fly   206 RILEVMQQEAIS 217

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity