DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LGR6 and Lgr4

DIOPT Version :9

Sequence 1:NP_001017403.1 Gene:LGR6 / 59352 HGNCID:19719 Length:967 Species:Homo sapiens
Sequence 2:NP_001285192.1 Gene:Lgr4 / 5740505 FlyBaseID:FBgn0085440 Length:809 Species:Drosophila melanogaster


Alignment Length:836 Identity:186/836 - (22%)
Similarity:280/836 - (33%) Gaps:277/836 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    39 CHCQEDGIMLSADCSELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLS 103
            |.|:.|.|:    |                     ....||::...|..|  .|..|.|:||:..
  Fly   162 CPCRGDEIL----C---------------------RFQQLTDIPERLPQH--DLATLDLTGNNFE 199

Human   104 HIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSS--LRH 166
            .|....||                        |||.:.||.|....|..:...:|:.|:.  ||.
  Fly   200 TIHETFFS------------------------ELPDVDSLVLKFCSIREIASHAFDRLADNPLRT 240

Human   167 LWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFE 231
            |::||                        |::.|:|::.|.....|.:|.|..|.:.||....|.
  Fly   241 LYMDD------------------------NKLPHLPEHFFPEGNQLSILILARNHLHHLKRSDFL 281

Human   232 GLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFV 296
            .|..|:.|||..|::..|...:                                           
  Fly   282 NLQKLQELDLRGNRIGNFEAEV------------------------------------------- 303

Human   297 GRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSH 361
                |..||.|..|.||.       ..||               ||.|....:.|..|..|.|::
  Fly   304 ----FARLPNLEVLYLNE-------NHLK---------------RLDPDRFPRTLLNLHTLSLAY 342

Human   362 NQIEEL-PSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFSTLHSLV 425
            ||||:: .:.....:|..:.|..||:..|..:||..||:||.|.|:.|.|.....|||:.|.:|.
  Fly   343 NQIEDIAANTFPFPRLRYLFLAGNRLSHIRDETFCNLSNLQGLHLNENRIEGFDLEAFACLKNLS 407

Human   426 KLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAY----QCCPYGMCA 486
            .|.||.|:..||                         ||.....:..:.|.|    ..|...|..
  Fly   408 SLLLTGNRFQTL-------------------------DSRVLKNLTSLDYIYFSWFHLCSAAMNV 447

Human   487 SFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPTPGP 551
            ......|...:..|||.|.:.                                            
  Fly   448 RVCDPHGDGISSKLHLLDNQI-------------------------------------------- 468

Human   552 FKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFVVGAIAGANTLTGISCG 616
                        :|.:||.:..::|:.|.||||..:.............:..:|.::.|.||...
  Fly   469 ------------LRGSVWVMASIAVVGNLLVLLGRYFYKSRSNVEHSLYLRHLAASDFLMGIYLT 521

Human   617 LLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLLTLAAVQCSVSVSCVRAYGKSP 681
            |:|..|....|::.:|...|.....|...|||:....::|.|||||......:||:  |.. |..
  Fly   522 LIACADISFRGEYIKYEETWRHSGVCAFAGFLSTFSCQSSTLLLTLVTWDRLMSVT--RPL-KPR 583

Human   682 SLGSVRAGVLGCLAL----AGLAAA--LPLASVGE--YGASPLCL------PYAPPEGQPAALGF 732
            ....||. ||..|.|    .|||||  ||....|.  ||.:.:||      |||......|.|  
  Fly   584 DTEKVRI-VLRLLLLWGISFGLAAAPLLPNPYFGSHFYGNNGVCLSLHIHDPYAKGWEYSALL-- 645

Human   733 TVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDC-------------AMVRHVAWLIFADGL 784
               .:::|:...:.:..:||::        .:|:.|.             .:....|.::..|..
  Fly   646 ---FILVNTLSLIFILFSYIRM--------LQAIRDSGGGMRSTHSGRENVVATRFAIIVTTDCA 699

Human   785 LYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR 840
            .:.|:..:..|::.|. .::|:....:.::|||:.:.|||:||.|....|:..|||
  Fly   700 CWLPIIVVKLAALSGC-EISPDLYAWLAVLVLPVNSALNPVLYTLTTAAFKQQLRR 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LGR6NP_001017403.1 LRRNT 34..68 CDD:214470 5/28 (18%)
LRR_RI <57..199 CDD:238064 27/143 (19%)
leucine-rich repeat 70..91 CDD:275380 4/20 (20%)
LRR 1 91..112 7/20 (35%)
LRR_8 92..150 CDD:290566 14/57 (25%)
leucine-rich repeat 92..115 CDD:275380 8/22 (36%)
LRR 2 115..136 0/20 (0%)
leucine-rich repeat 116..139 CDD:275380 2/22 (9%)
LRR_RI 131..392 CDD:238064 57/263 (22%)
LRR 3 139..160 5/20 (25%)
leucine-rich repeat 140..163 CDD:275380 6/22 (27%)
LRR 4 163..186 5/24 (21%)
leucine-rich repeat 164..187 CDD:275380 5/22 (23%)
LRR_8 186..246 CDD:290566 17/59 (29%)
LRR 5 187..208 4/20 (20%)
leucine-rich repeat 188..211 CDD:275380 4/22 (18%)
LRR 6 211..232 7/20 (35%)
leucine-rich repeat 212..235 CDD:275380 8/22 (36%)
LRR 7 235..256 6/20 (30%)
leucine-rich repeat 236..258 CDD:275380 6/21 (29%)
LRR_8 258..314 CDD:290566 6/55 (11%)
LRR 8 258..279 0/20 (0%)
leucine-rich repeat 259..282 CDD:275380 0/22 (0%)
LRR 9 282..303 1/20 (5%)
leucine-rich repeat 283..304 CDD:275380 1/20 (5%)
LRR 10 306..328 6/21 (29%)
LRR 11 329..350 3/20 (15%)
leucine-rich repeat 330..344 CDD:275378 2/13 (15%)
LRR 12 353..374 7/21 (33%)
leucine-rich repeat 354..399 CDD:275380 15/45 (33%)
LRR_8 375..434 CDD:290566 24/58 (41%)
LRR 13 375..396 7/20 (35%)
leucine-rich repeat 376..390 CDD:275378 4/13 (31%)
LRR 14 399..420 9/20 (45%)
leucine-rich repeat 400..423 CDD:275380 10/22 (45%)
LRR 15 423..443 7/19 (37%)
leucine-rich repeat 424..444 CDD:275380 7/19 (37%)
Lgr4NP_001285192.1 Ldl_recept_a 87..124 CDD:278486
LRR_RI <184..397 CDD:238064 76/331 (23%)
LRR_8 188..248 CDD:290566 23/107 (21%)
leucine-rich repeat 188..211 CDD:275380 10/46 (22%)
leucine-rich repeat 212..235 CDD:275380 6/22 (27%)
leucine-rich repeat 238..261 CDD:275380 9/46 (20%)
LRR_8 261..320 CDD:290566 21/112 (19%)
leucine-rich repeat 262..285 CDD:275380 8/22 (36%)
LRR_4 284..325 CDD:289563 17/109 (16%)
leucine-rich repeat 286..309 CDD:275380 8/69 (12%)
LRR_4 308..348 CDD:289563 18/61 (30%)
leucine-rich repeat 310..334 CDD:275380 10/45 (22%)
leucine-rich repeat 335..357 CDD:275380 7/21 (33%)
LRR_8 356..416 CDD:290566 24/59 (41%)
leucine-rich repeat 358..381 CDD:275380 8/22 (36%)
LRR_4 381..421 CDD:289563 17/64 (27%)
leucine-rich repeat 382..405 CDD:275380 10/22 (45%)
leucine-rich repeat 406..427 CDD:275380 9/45 (20%)
7tm_1 483..741 CDD:278431 69/275 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.