DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LGR6 and Con

DIOPT Version :10

Sequence 1:NP_001017403.1 Gene:LGR6 / 59352 HGNCID:19719 Length:967 Species:Homo sapiens
Sequence 2:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:374 Identity:100/374 - (26%)
Similarity:158/374 - (42%) Gaps:66/374 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    39 CHCQEDG---IMLSADC---SELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRL 97
            |:|..|.   .:..|:|   ||                 .|..|:.|..:   |:..:.|.||:.
  Fly   119 CYCTPDENHVPVQKAECWVFSE-----------------GLHQNDTTWTR---FYQQKRLRELKF 163

Human    98 ---SGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFE 159
               :...|.:||......|.:|..::::.:|:..:.:.|...||.|:.:.|:.|.|..:.:.:|.
  Fly   164 VIQNNARLDYIPTMIIEPLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFA 228

Human   160 GLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQH 224
            ....||.|.|:.|.:.|:...|..|||..:.:.|..|.||.:.:..|.::..|..|:|.:|:|..
  Fly   229 NHIRLRELNLEHNQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINV 293

Human   225 LGTHSFEGLHNLETLDLNYNKLQEF-PVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHF 288
            |.:..|.||.||..|.|..|.|... ......|..|.||...:|.|:.|.|:|..|...|:|::.
  Fly   294 LTSEIFRGLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNL 358

Human   289 YDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILT----------LTRAGIRLL 343
            .:|.::.:.....:..|.|  ||:|    :|       ...||.||          |..:...||
  Fly   359 RNNLLKKIDNGLLRGTPAL--LSIN----VQ-------ANKLETLTFYTFQPIMDNLVNSTSELL 410

Human   344 PSG---MCQQLPRLR-VLELS----HNQI-EELPSLHRCQKLEEIGLQH 383
            .|.   :|.  .||: :.||.    |.|: :.|..|| | .|:|..|.|
  Fly   411 VSDNKFICD--CRLQWIFELKNRTRHLQLRDSLEDLH-C-TLQEPKLSH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LGR6NP_001017403.1 LRRNT 34..68 CDD:214470 7/34 (21%)
LRR <70..>293 CDD:443914 64/226 (28%)
leucine-rich repeat 70..91 CDD:275380 4/20 (20%)
LRR 1 91..112 6/23 (26%)
leucine-rich repeat 92..115 CDD:275380 7/25 (28%)
LRR 2 115..136 3/20 (15%)
leucine-rich repeat 116..139 CDD:275380 4/22 (18%)
LRR 3 139..160 5/20 (25%)
leucine-rich repeat 140..163 CDD:275380 5/22 (23%)
LRR 4 163..186 8/22 (36%)
leucine-rich repeat 164..187 CDD:275380 9/22 (41%)
LRR 5 187..208 5/20 (25%)
leucine-rich repeat 188..211 CDD:275380 5/22 (23%)
LRR 6 211..232 7/20 (35%)
leucine-rich repeat 212..235 CDD:275380 9/22 (41%)
LRR 7 235..256 6/21 (29%)
leucine-rich repeat 236..258 CDD:275380 6/22 (27%)
LRR 8 258..279 8/20 (40%)
leucine-rich repeat 259..282 CDD:275380 9/22 (41%)
LRR_8 281..364 CDD:404697 23/100 (23%)
LRR 9 282..303 3/20 (15%)
leucine-rich repeat 283..304 CDD:275380 3/20 (15%)
LRR 10 306..328 5/21 (24%)
LRR 11 329..350 9/33 (27%)
leucine-rich repeat 330..344 CDD:275378 6/23 (26%)
LRR <349..>473 CDD:443914 14/41 (34%)
LRR 12 353..374 9/26 (35%)
leucine-rich repeat 354..399 CDD:275380 13/36 (36%)
LRR 13 375..396 4/9 (44%)
leucine-rich repeat 376..390 CDD:275378 4/8 (50%)
LRR 14 399..420
leucine-rich repeat 400..423 CDD:275380
LRR 15 423..443
leucine-rich repeat 424..444 CDD:275380
7tmA_LGR6 562..834 CDD:320484
TM helix 1 563..589 CDD:320484
TM helix 2 597..622 CDD:320484
TM helix 3 642..672 CDD:320484
TM helix 4 684..706 CDD:320484
TM helix 5 728..757 CDD:320484
TM helix 6 766..796 CDD:320484
TM helix 7 806..831 CDD:320484
ConNP_523930.3 LRR <157..459 CDD:443914 89/316 (28%)
leucine-rich repeat 185..208 CDD:275380 4/22 (18%)
leucine-rich repeat 209..232 CDD:275380 5/22 (23%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 5/22 (23%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
leucine-rich repeat 305..328 CDD:275380 6/22 (27%)
leucine-rich repeat 329..352 CDD:275380 9/22 (41%)
leucine-rich repeat 353..376 CDD:275380 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.