DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RXFP1 and CG4168

DIOPT Version :10

Sequence 1:NP_001240656.1 Gene:RXFP1 / 59350 HGNCID:19718 Length:784 Species:Homo sapiens
Sequence 2:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:356 Identity:70/356 - (19%)
Similarity:130/356 - (36%) Gaps:98/356 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    73 YNGFQE--NGDY--------NKPIPAQYMEHLNHVVSSVPSPRDPAQPQQWVSSQVLLCRRCSHH 127
            ||..::  ..||        .:||..:.:..||.:::  ..||..::.:.:..|.:..|  |.  
  Fly   736 YNNGEDLIGKDYLWRVITAGQEPIAHRAINILNEMMT--VGPRQLSEMKAYHESFIEEC--CE-- 794

Human   128 QTTKIKQLAAF-----------TPREEGRYDEEIEVYRHHLEQMYKLCRPCQAAVEYYIKHQNRQ 181
                 |..|.|           :|:...:...|.|..|..|..:.::||..:...| ||:..:|:
  Fly   795 -----KLRAMFQSMEMLLREFPSPKPVSKKGNEKESSRKKLLLVDQMCRMIRTLQE-YIRECDRK 853

Human   182 LR----ALLLSHQFRRREAD-----QAHGQSFS-------SSAVKAPFQVILLRALAFL------ 224
            ..    ||.|.|..|.|:.:     |..|:...       |:.....|:..|||.:..|      
  Fly   854 YPGDRFALPLCHAVRGRQVELIVKFQTPGRQLDDIELLSHSNETMHSFKRNLLRRIKVLKANEIR 918

Human   225 -------------------ACAFLLFTTLYGPSEPFTPGAALPP---ALPPGGNSSAASDNTT-- 265
                               ..||      ||..:..:..|.|.|   .|...|:..::|::::  
  Fly   919 VDLYDNGTNELIMVPDDQQTLAF------YGIRDKMSLIAKLTPVSSGLMAAGSPDSSSESSSGS 977

Human   266 -----SQAEGWQQLLGLL----PEHATEKLHEAWAFGQSHQTSIVAVGLLTCLLAMLLAGRIRLR 321
                 |.:|....|.|::    |:: |:...:.:....:.:...:..|:.: ||.:|...|:.:.
  Fly   978 PPRNYSASESEDTLPGVVIAQKPQY-TQFFLQVYQLANALEHDRLRDGVRS-LLHLLPLDRMTVN 1040

Human   322 RI-DAFSTCLWALLLGLHLA-EHYLQAASPG 350
            .: :.|:|...|:.....:| |.|:.|...|
  Fly  1041 NLYEVFNTAQGAIEDARKVAMEAYMAARESG 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RXFP1NP_001240656.1 LDLa 27..62 CDD:238060
leucine-rich repeat 155..178 CDD:275380 6/22 (27%)
LRR <173..>387 CDD:443914 46/235 (20%)
leucine-rich repeat 179..202 CDD:275380 8/31 (26%)
leucine-rich repeat 203..226 CDD:275380 6/54 (11%)
leucine-rich repeat 227..250 CDD:275380 7/25 (28%)
leucine-rich repeat 251..275 CDD:275380 5/30 (17%)
leucine-rich repeat 276..299 CDD:275380 3/26 (12%)
leucine-rich repeat 300..323 CDD:275380 5/22 (23%)
leucine-rich repeat 324..347 CDD:275380 6/23 (26%)
leucine-rich repeat 348..371 CDD:275380 1/3 (33%)
leucine-rich repeat 372..393 CDD:275380
7tmA_RXFP1_LGR7 433..719 CDD:320631
TM helix 1 434..460 CDD:320631
TM helix 2 467..492 CDD:320631
TM helix 3 512..542 CDD:320631
TM helix 4 553..575 CDD:320631
TM helix 5 603..632 CDD:320631
TM helix 6 648..678 CDD:320631
TM helix 7 687..712 CDD:320631
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR 543..971 CDD:443914 50/252 (20%)
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
leucine-rich repeat 688..711 CDD:275380
leucine-rich repeat 712..735 CDD:275380
leucine-rich repeat 740..783 CDD:275380 8/44 (18%)
leucine-rich repeat 785..808 CDD:275380 6/31 (19%)
leucine-rich repeat 809..832 CDD:275380 5/22 (23%)
leucine-rich repeat 833..856 CDD:275380 6/23 (26%)
leucine-rich repeat 857..879 CDD:275380 6/21 (29%)
leucine-rich repeat 880..900 CDD:275380 2/19 (11%)
leucine-rich repeat 905..928 CDD:275380 4/22 (18%)
LRR 911..>1203 CDD:443914 30/169 (18%)
leucine-rich repeat 929..952 CDD:275380 4/28 (14%)
leucine-rich repeat 953..977 CDD:275380 5/23 (22%)
leucine-rich repeat 978..1020 CDD:275380 6/42 (14%)
leucine-rich repeat 1045..1068 CDD:275380 6/22 (27%)
leucine-rich repeat 1069..1090 CDD:275380 1/3 (33%)
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.