DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RXFP1 and rk

DIOPT Version :10

Sequence 1:NP_001240656.1 Gene:RXFP1 / 59350 HGNCID:19718 Length:784 Species:Homo sapiens
Sequence 2:NP_476702.1 Gene:rk / 34819 FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster


Alignment Length:39 Identity:14/39 - (35%)
Similarity:21/39 - (53%) Gaps:8/39 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   277 LLPEH---ATEK--LH---EAWAFGQSHQTSIVAVGLLT 307
            |:||.   ||..  ||   ||:||.:::...:.:.||.|
  Fly   255 LVPEALLVATSSVFLHAPVEAYAFEKANNGFLYSNGLST 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RXFP1NP_001240656.1 LDLa 27..62 CDD:238060
leucine-rich repeat 155..178 CDD:275380
LRR <173..>387 CDD:443914 14/39 (36%)
leucine-rich repeat 179..202 CDD:275380
leucine-rich repeat 203..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..275 CDD:275380
leucine-rich repeat 276..299 CDD:275380 11/29 (38%)
leucine-rich repeat 300..323 CDD:275380 3/8 (38%)
leucine-rich repeat 324..347 CDD:275380
leucine-rich repeat 348..371 CDD:275380
leucine-rich repeat 372..393 CDD:275380
7tmA_RXFP1_LGR7 433..719 CDD:320631
TM helix 1 434..460 CDD:320631
TM helix 2 467..492 CDD:320631
TM helix 3 512..542 CDD:320631
TM helix 4 553..575 CDD:320631
TM helix 5 603..632 CDD:320631
TM helix 6 648..678 CDD:320631
TM helix 7 687..712 CDD:320631
rkNP_476702.1 LRR <157..390 CDD:443914 14/39 (36%)
leucine-rich repeat 158..179 CDD:275380
leucine-rich repeat 183..204 CDD:275380
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
leucine-rich repeat 253..276 CDD:275380 8/20 (40%)
leucine-rich repeat 277..300 CDD:275380 5/17 (29%)
LRR 292..612 CDD:443914 1/2 (50%)
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380
leucine-rich repeat 349..371 CDD:275380
leucine-rich repeat 372..393 CDD:275380
leucine-rich repeat 394..415 CDD:275380
leucine-rich repeat 418..486 CDD:275380
leucine-rich repeat 441..464 CDD:275378
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..558 CDD:275380
leucine-rich repeat 559..580 CDD:275380
7tmA_Glyco_hormone_R 754..1028 CDD:320264
TM helix 1 755..781 CDD:320264
TM helix 2 788..813 CDD:320264
TM helix 3 833..863 CDD:320264
TM helix 4 875..897 CDD:320264
TM helix 5 918..947 CDD:320264
TM helix 6 956..986 CDD:320264
TM helix 7 996..1021 CDD:320264
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.