DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and RNA15

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_011471.1 Gene:RNA15 / 852838 SGDID:S000003012 Length:296 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:32/132 - (24%)
Similarity:63/132 - (47%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     8 LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESL 72
            :::|.:.::..|:.:.|..|:.||:..:.::.|.:|.||:|:.||.|.:.|.::.|:|.:||..|
Yeast    20 VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQL 84

Human    73 DGRQIRV------DHAGKSARGTR-----GGGFGAHGRGRSYSRGGGDQGYGSGRYYDSR----P 122
            ..|.::.      |.:|.|.:..:     .|....:|...:.|.|...|..|:..:...:    |
Yeast    85 GSRFLKCGYSSNSDISGVSQQQQQQYNNINGNNNNNGNNNNNSNGPDFQNSGNANFLSQKFPELP 149

Human   123 GG 124
            .|
Yeast   150 SG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 23/82 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 10/53 (19%)
RNA15NP_011471.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 21/73 (29%)
CSTF_C 255..291 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100265
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.