DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and cirbpb

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:204 Identity:98/204 - (48%)
Similarity:119/204 - (58%) Gaps:53/204 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     3 SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAM 67
            |:|||||:|||:::|.||:||:.||.:|.|::|.|::||||.|||||||:||.|||.|..||.||
Zfish     2 SDEGKLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAM 66

Human    68 NGESLDGRQIRVDHAGKSA------------------RGTRGGGFGAHGRGRSY----------- 103
            ||:.:|||.||||.||||.                  ||:||.|.|.:|..|||           
Zfish    67 NGKQVDGRMIRVDEAGKSGGRSGGFRGGSRGGGRGFFRGSRGRGGGGYGGDRSYGSDRSFGGDRS 131

Human   104 -----SRGGGDQGYGSGRY---------------YDSRPGGYGYGYGRSRDYNGRNQGGYDRYSG 148
                 |.||||:|||.|..               |.:|.|||..| |..||  .|||||||| ||
Zfish   132 YGGDRSYGGGDRGYGGGERSYGGGDRSYGGGGGGYSNRSGGYSSG-GGYRD--NRNQGGYDR-SG 192

Human   149 GNYRDNYDN 157
            |:|||.||:
Zfish   193 GSYRDGYDS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 50/78 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 47/124 (38%)
cirbpbNP_001035411.2 RRM <2..>81 CDD:223796 50/78 (64%)
RRM_SF 5..83 CDD:302621 49/77 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG43500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 1 1.000 - - otm28540
orthoMCL 1 0.900 - - OOG6_100265
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.