Sequence 1: | NP_006734.1 | Gene: | RBM3 / 5935 | HGNCID: | 9900 | Length: | 157 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035411.2 | Gene: | cirbpb / 678563 | ZFINID: | ZDB-GENE-030131-5841 | Length: | 206 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 98/204 - (48%) |
---|---|---|---|
Similarity: | 119/204 - (58%) | Gaps: | 53/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 3 SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAM 67
Human 68 NGESLDGRQIRVDHAGKSA------------------RGTRGGGFGAHGRGRSY----------- 103
Human 104 -----SRGGGDQGYGSGRY---------------YDSRPGGYGYGYGRSRDYNGRNQGGYDRYSG 148
Human 149 GNYRDNYDN 157 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RBM3 | NP_006734.1 | RRM_CIRBP_RBM3 | 6..85 | CDD:409883 | 50/78 (64%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..157 | 47/124 (38%) | |||
cirbpb | NP_001035411.2 | RRM | <2..>81 | CDD:223796 | 50/78 (64%) |
RRM_SF | 5..83 | CDD:302621 | 49/77 (64%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
NCBI | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG43500 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000446 | |
OrthoInspector | 1 | 1.000 | - | - | otm28540 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100265 | |
Panther | 1 | 1.100 | - | - | O | PTHR48034 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.880 |