DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and cirbpa

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001017797.1 Gene:cirbpa / 550495 ZFINID:ZDB-GENE-050417-329 Length:185 Species:Danio rerio


Alignment Length:184 Identity:86/184 - (46%)
Similarity:106/184 - (57%) Gaps:34/184 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     3 SEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAM 67
            |:|||||:|||:|:|.||:|||.||.:|.|:.|.|.::|||.|||||||:||.||:.|..|:..|
Zfish     2 SDEGKLFIGGLSFDTTEQSLEDAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGM 66

Human    68 NGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSR---PGGYGYGY 129
            ||:|:|||.||||.|||..    |||.|..|.|.||..|||.:|.|.|.:...|   .||.||| 
Zfish    67 NGKSVDGRTIRVDEAGKGG----GGGGGRSGGGGSYRGGGGGRGGGGGFFRGGRGRGGGGGGYG- 126

Human   130 GRSRDYNGRNQGG---------------------YDRYSG-----GNYRDNYDN 157
            |..|.|..|:.||                     .||.||     .:|:|.||:
Zfish   127 GGDRSYGDRSYGGGGGGYKSGGGGYSSGGGGGYNRDRGSGYGDRSSSYKDGYDS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 49/78 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 36/104 (35%)
cirbpaNP_001017797.1 RRM <2..>81 CDD:223796 49/78 (63%)
RRM_SF 5..83 CDD:302621 48/77 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG43500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100265
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.