DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and cirbp

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:166 Identity:97/166 - (58%)
Similarity:117/166 - (70%) Gaps:14/166 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMR 65
            ||.:|||||||||||.|.|::||..||.:|.::|||||||||::|||||||:||.|||.|..||.
 Frog     1 MSCDEGKLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMM 65

Human    66 AMNGESLDGRQIRVDHAGKSARGTRGG---------GFGAHGRGRSYSRGGGDQGYGSGRYYDSR 121
            ||||:|:||||||||.||||:...|||         ||...||||.   ||||:|||....:::|
 Frog    66 AMNGKSVDGRQIRVDQAGKSSNDRRGGYRGGSSGGRGFFRGGRGRG---GGGDRGYGGSSRFENR 127

Human   122 PGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN 157
            .|  ||....||||.||:.|.|...|||:|||:||:
 Frog   128 SG--GYQSSGSRDYYGRSHGSYGDRSGGSYRDSYDS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 56/78 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 39/84 (46%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 56/78 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 51/99 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG43500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.