DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and Hrb87F

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:227 Identity:65/227 - (28%)
Similarity:87/227 - (38%) Gaps:82/227 - (36%)


- Green bases have known domain annotations that are detailed below.


Human     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPE----------HA- 60
            |||||||..:.||:.|.::|..||.|..|.:|.|::|.:.|||.||.|.:.:          |: 
  Fly   116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSI 180

Human    61 ---------SVAMRAMN---------GESLDGRQIRVDHAGKSARGTRGGGFGAHGR-------- 99
                     ::|.:.|:         |....||      .|:..||..|||:|...|        
  Fly   181 KNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGR------GGQGDRGQGGGGWGGQNRQNGGGNWG 239

Human   100 --------GRSYSRGGGDQGYGSGRYYD-------------------SRPGGYGYGYGRSRDYNG 137
                    |.|....||.||.|||.:..                   :..||.|||.|.|....|
  Fly   240 GAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWG 304

Human   138 RNQGG----------YDR-YSGGNYRD-NYDN 157
            .|.||          |.: |.||..|: |:.|
  Fly   305 GNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 31/106 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 34/122 (28%)
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022
RRM_SF 116..188 CDD:302621 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.