DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and sqd

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:257 Identity:68/257 - (26%)
Similarity:86/257 - (33%) Gaps:111/257 - (43%)


- Green bases have known domain annotations that are detailed below.


Human     4 EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRA-- 66
            ::.|||||||::.|.|:.|.|||..:|.|..:.|..|.:|.|||||.||.|||.|.......|  
  Fly    54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Human    67 --MNGESLDGRQIRVDH------------------------------------------------ 81
              :|.:.:|.::.:..|                                                
  Fly   119 HIINSKKVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFIT 183

Human    82 ------------------AGKSA-------------------------RGTRG--GGFGAH---- 97
                              |||..                         ||.||  ||.|.:    
  Fly   184 FDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPRGGMRGGRGGYGGRGGYNNQW 248

Human    98 -GRGRSYSRGGGDQGYGSGRYYDSRPGGY---------GYGYGRSRDYNGRNQGGYDRYSGG 149
             |:|.....|||..|||:|.|.|...|||         |||||...:.||...||.....||
  Fly   249 DGQGSYGGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 35/148 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 36/176 (20%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 31/70 (44%)
RRM2_hnRNPD_like 137..211 CDD:240775 3/73 (4%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.