Sequence 1: | NP_006734.1 | Gene: | RBM3 / 5935 | HGNCID: | 9900 | Length: | 157 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731825.1 | Gene: | sqd / 41666 | FlyBaseID: | FBgn0263396 | Length: | 344 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 68/257 - (26%) |
---|---|---|---|
Similarity: | 86/257 - (33%) | Gaps: | 111/257 - (43%) |
- Green bases have known domain annotations that are detailed below.
Human 4 EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRA-- 66
Human 67 --MNGESLDGRQIRVDH------------------------------------------------ 81
Human 82 ------------------AGKSA-------------------------RGTRG--GGFGAH---- 97
Human 98 -GRGRSYSRGGGDQGYGSGRYYDSRPGGY---------GYGYGRSRDYNGRNQGGYDRYSGG 149 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RBM3 | NP_006734.1 | RRM_CIRBP_RBM3 | 6..85 | CDD:409883 | 35/148 (24%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..157 | 36/176 (20%) | |||
sqd | NP_731825.1 | RRM_SF | 58..129 | CDD:302621 | 31/70 (44%) |
RRM2_hnRNPD_like | 137..211 | CDD:240775 | 3/73 (4%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |