DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and SLIRP1

DIOPT Version :10

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:76 Identity:21/76 - (27%)
Similarity:39/76 - (51%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGES 71
            ::|||.|.:....|.|..:|..||.:....|:.|:.|..|:|:||::|    ::..|:..:..|.
  Fly    16 RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSF----NSLTALEKIENEQ 76

Human    72 ---LDGRQIRV 79
               |:|..:.:
  Fly    77 KHILEGNYLNI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 21/76 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.