DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and tra2

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:149 Identity:51/149 - (34%)
Similarity:71/149 - (47%) Gaps:27/149 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    10 VGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDG 74
            |.|||.||.:..:.:.|:.:|||..:.:|.|.:|||||||.||.|.....|..|..:.:|..:||
  Fly   101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDG 165

Human    75 RQIRVDHA--GKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNG 137
            |:||||.:  .::...|.|...|...||::                   |..:....|| |.|:.
  Fly   166 RRIRVDFSITQRAHTPTPGVYLGRQPRGKA-------------------PRSFSPRRGR-RVYHD 210

Human   138 RNQGGYDRYSGGNYRDNYD 156
            |:...||     ||||.||
  Fly   211 RSASPYD-----NYRDRYD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 32/76 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 19/78 (24%)
tra2NP_476764.1 RRM <74..242 CDD:223796 51/149 (34%)
RRM_TRA2 98..175 CDD:240809 32/73 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.