DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and Rsf1

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster


Alignment Length:181 Identity:55/181 - (30%)
Similarity:77/181 - (42%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSEEG-KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAM 64
            |..:.| :::||.|.....:..||..|:.:|.::.|.:..:     ..||.|:.|.:.:.|..|.
  Fly     4 MGDQRGTRVYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKAC 63

Human    65 RAMNGESLDGRQIRVD----------HAGKSARGTRGGGFGAHGRGRSYSRGGG----------- 108
            ..:||..|.|.|:||:          ..|...||.|.|.||.|......|.|||           
  Fly    64 DILNGSELLGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSS 128

Human   109 ---DQGYGSGR----YYDSRPGGYGYGYGRSRDYNGRNQGGYD--RYSGGN 150
               ::||.|||    .|:.|.|| |.|:.|...|.    ||.|  |||.|:
  Fly   129 RHTERGYSSGRSGASSYNGREGG-GSGFNRREVYG----GGRDSSRYSSGS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 23/89 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 32/90 (36%)
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.