DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and SPAC25G10.01

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001342863.1 Gene:SPAC25G10.01 / 3361412 PomBaseID:SPAC25G10.01 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:166 Identity:51/166 - (30%)
Similarity:73/166 - (43%) Gaps:44/166 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     2 SSEEGK------LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA 60
            |:.||.      |||.|:.....|..|:..||.||.::.|.::::..|:.||||||::|:..|.|
pombe    91 SAPEGSENLGNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTVEEA 155

Human    61 SVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGY 125
            :.|:..:|.:...||.:.|..|.:|                              |.:...||.|
pombe   156 TSAIDNLNSQEFYGRVLNVQKAKRS------------------------------RPHSPTPGKY 190

Human   126 GYGYGR---SRDYNGRNQ-GGYDRYSGGNYRDNYDN 157
             .||.|   |||:...|: |||.|   .||||...|
pombe   191 -MGYDRRRNSRDFPSNNKDGGYRR---NNYRDRDSN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 28/84 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 21/79 (27%)
SPAC25G10.01NP_001342863.1 RRM 9..>225 CDD:223796 51/166 (31%)
RRM_RBMX_like 100..179 CDD:240828 27/78 (35%)
RRM 207..>283 CDD:330708 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 1 1.000 - - otm53853
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.