DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and ssx

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:116 Identity:32/116 - (27%)
Similarity:56/116 - (48%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     2 SSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRA 66
            |.::..|:|..|:.|.::..|:..||.:|.|.:..:::|:.|.|.||..|:.:...|.|..|::|
  Fly   175 SIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKA 239

Human    67 MNGESLDGRQ----IRVDHAGKSARGTR-----GGGFGAHGRGRSYSRGGG 108
            :|....:|..    :|:......|:..:     |||.|..|.|..:...||
  Fly   240 LNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPGG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 22/82 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 9/33 (27%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621
RRM_SF 179..257 CDD:302621 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.