DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM3 and Rbm3

DIOPT Version :9

Sequence 1:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens
Sequence 2:NP_001159881.1 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:157 Identity:149/157 - (94%)
Similarity:152/157 - (96%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMR 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||
Mouse     1 MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMR 65

Human    66 AMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYG 130
            |||||||||||||||||||||||:|||.||  ||||||||||||||||||| |||||||||||||
Mouse    66 AMNGESLDGRQIRVDHAGKSARGSRGGAFG--GRGRSYSRGGGDQGYGSGR-YDSRPGGYGYGYG 127

Human   131 RSRDYNGRNQGGYDRYSGGNYRDNYDN 157
            |||||:||:||||||||||||||||||
Mouse   128 RSRDYSGRSQGGYDRYSGGNYRDNYDN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 77/78 (99%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 68/75 (91%)
Rbm3NP_001159881.1 RRM_CIRBP_RBM3 6..85 CDD:240895 77/78 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83972870
Domainoid 1 1.000 148 1.000 Domainoid score I34492
eggNOG 1 0.900 - - E33208_3BY0V
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31404
Inparanoid 1 1.050 299 1.000 Inparanoid score I15119
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43500
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000446
OrthoInspector 1 1.000 - - oto126504
orthoMCL 1 0.900 - - OOG6_100265
Panther 1 1.100 - - LDO PTHR48034
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R15931
SonicParanoid 1 1.000 - - X10511
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.290

Return to query results.
Submit another query.