DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF350 and CG9215

DIOPT Version :9

Sequence 1:XP_016882583.1 Gene:ZNF350 / 59348 HGNCID:16656 Length:574 Species:Homo sapiens
Sequence 2:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster


Alignment Length:317 Identity:92/317 - (29%)
Similarity:130/317 - (41%) Gaps:53/317 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   221 PASQKLISTKSQFISP--KHQK-TRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCE 282
            ||:|:...|..: :||  ||:| |..::.........|.            .:....|..|.:|.
  Fly   260 PANQQKKRTYRR-VSPNVKHEKLTANVDDDFKAGSTTKR------------RNCERSPKICDVCG 311

Human   283 KAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFIQKGNL 347
            ..:..:..|..|.|.|..|:||.|..|.|||:....|..|.:.|||:|||.|..|.:.|...|:.
  Fly   312 NTYKYQHALNAHMRRHNNERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSS 376

Human   348 IVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTG 412
            ..|:||||||:||:|..|.|||.....|.||:|.||||                           
  Fly   377 KKHERIHTGERPYVCEVCNKGFAYAHVLSAHRRTHTGK--------------------------- 414

Human   413 EKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVE 477
             |.|:|::|.|.|:.|..|..|...|.|.   |..|...|.:......:::....| |:.|.|.:
  Fly   415 -KQFQCTQCDKGFTKKTYLSAHMEQHRGS---GNGEASVASSSADASSRNQNASAR-KESARKQQ 474

Human   478 NPPAERHS----SLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVG 530
            ..| |..|    .|..:.|::|...||.........|.|.:.:..||..:.:...||
  Fly   475 QIP-ESFSLDSVELEQTKVLEECIVANDFMFNEEDNAEQEANDREGLQHDDSYPYVG 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF350XP_016882583.1 None
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 4/13 (31%)
COG5048 <303..439 CDD:227381 58/163 (36%)
C2H2 Zn finger 307..327 CDD:275368 5/19 (26%)
zf-H2C2_2 319..344 CDD:290200 12/24 (50%)
zf-C2H2 333..355 CDD:278523 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
zf-H2C2_2 347..371 CDD:290200 10/23 (43%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-H2C2_2 375..400 CDD:290200 14/24 (58%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
zf-H2C2_2 404..427 CDD:290200 13/50 (26%)
C2H2 Zn finger 419..439 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.