DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ereg and Krn

DIOPT Version :9

Sequence 1:NP_067721.1 Gene:Ereg / 59325 RGDID:620299 Length:162 Species:Rattus norvegicus
Sequence 2:NP_524129.1 Gene:Krn / 326198 FlyBaseID:FBgn0052179 Length:217 Species:Drosophila melanogaster


Alignment Length:174 Identity:41/174 - (23%)
Similarity:70/174 - (40%) Gaps:26/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat     9 VLALLCLGSHL-LQAVISTTVI----PSCIPEESEDNCTALVQMEDDPR--VAQVLITKCSSDMD 66
            :||...:|::| |.|..|:..|    |:..|....||    |::...||  |...:.....:.:.
  Fly     8 LLATALIGAYLPLTAACSSRAIAKPRPTAAPILPPDN----VEISTTPRPNVTFPIFACPPTYVA 68

  Rat    67 GYCLHGHCIYLVDMSEKY---CRCEVGYTGLRCEH-----FFLTVHQPLSREYVALT--VILVFL 121
            .|||:....:.|.:..:.   |.|.:|:.|.|||:     .:|.....:..|..::.  ..|..|
  Fly    69 WYCLNDGTCFTVKIHNEILYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLEKASIVSGATLALL 133

  Rat   122 FLIVTAGSMYYFCRWYRNRKSKKSREEYERVTSGG---PGLPQV 162
            |:.:....:|  .|..:.:|.|.........|.||   .|:.:|
  Fly   134 FMAMCCVVLY--LRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EregNP_067721.1 PHA03099 <58..146 CDD:165381 20/97 (21%)
KrnNP_524129.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.