DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGIRR and CG45263

DIOPT Version :9

Sequence 1:XP_005253101.1 Gene:SIGIRR / 59307 HGNCID:30575 Length:504 Species:Homo sapiens
Sequence 2:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster


Alignment Length:442 Identity:79/442 - (17%)
Similarity:123/442 - (27%) Gaps:171/442 - (38%)


- Green bases have known domain annotations that are detailed below.


Human     9 PDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKAN 73
            |..:|...|::....|.|..|..|.|  ...|   |||.:|::          ...|...:|:..
  Fly   372 PKIISAGPDRLTTAPLFSPAAFECLA--DGNP---LPSFKWVQ----------RMAHGSKYVERG 421

Human    74 LSEVLVSSVLGVNVTSTEVYGAFTCSI-------QNISFSS-FTLQRAG--------PTSHVAAV 122
            ....||..    ||| .|..|.:.|..       :.::.|. .:||..|        |:.|..:|
  Fly   422 SESRLVID----NVT-YEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLHTVSV 481

Human   123 LASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKP 187
            .......|.:::.|    ..|...:.|   .:|.:.:..|...|.:.:....|:.|:        
  Fly   482 KRGEAASLTMVVCA----DPRPQRVAW---EWGSLRLEAGSGIDRFRADDMQPDTRE-------- 531

Human   188 QLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLEL 252
                                                      |.:||.....|:.        |.
  Fly   532 ------------------------------------------DCYLSTLHILHAD--------EH 546

Human   253 TRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQY-RPV 316
            ..||.::..|.:|           ...||.:.|::              |...|.|.::.| ..|
  Fly   547 DSRPYYLVVENER-----------GTDRHAIHLIV--------------EGTFAEPYEMSYLMGV 586

Human   317 EGDPQTQL-------------------------QDDKDPMLILRGRVPEGRALDSEVD--PDPEG 354
            .|.....:                         ..|||         .|...|.|..|  ..|:|
  Fly   587 AGGCMAAILLLVCLCIYAIKSKRCCFKGSTGYKSSDKD---------SEKADLKSRSDSTSGPQG 642

Human   355 D--LGMPAQPHSPTGEAQHRAEWGQAQGTGPGGAPGVEDSSRHRE---PLHG 401
            |  ...||..|.   ..|.:.:..|.|......|..:..:|:|.:   |.||
  Fly   643 DSIYTTPAGFHH---HQQQQQQQQQQQHAAAAAAAALHAASQHPQQQYPGHG 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGIRRXP_005253101.1 Ig 8..111 CDD:299845 24/109 (22%)
TIR 165..311 CDD:279864 18/145 (12%)
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845
IG_like 302..368 CDD:214653
IGc2 302..357 CDD:197706
Ig 372..446 CDD:299845 23/93 (25%)
Ig 475..568 CDD:299845 22/168 (13%)
IG_like 478..570 CDD:214653 22/167 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.