DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGIRR and Toll-9

DIOPT Version :9

Sequence 1:XP_005253101.1 Gene:SIGIRR / 59307 HGNCID:30575 Length:504 Species:Homo sapiens
Sequence 2:NP_001246846.1 Gene:Toll-9 / 40245 FlyBaseID:FBgn0036978 Length:900 Species:Drosophila melanogaster


Alignment Length:262 Identity:58/262 - (22%)
Similarity:107/262 - (40%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    70 VKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLL 134
            :|..|.:...|.....|.|.........|.|:::|..:..|...  |:.|.||:.||:.  |.:|
  Fly   644 LKFQLLDYEASQYYCFNNTDQLQVDELNCQIRSMSDLAEELHHV--TNTVIAVMGSLVG--ACIL 704

Human   135 AALLYVKCRLNVLLWYQ----------------DAYGEVEIND-GKLYDAYVSYSDCPEDRKFVN 182
            ..::|:| |.::..:|.                :.:..:...| ..:||.::||  |..||.:|.
  Fly   705 GFIIYLK-RWHIHYYYSSLKSAALLSSASKESVNKFTNISQRDPSAVYDIFISY--CQNDRTWVL 766

Human   183 FILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCR----RLIVVLSDAFLSRAWCSHSFR 243
            ..|.|.:|......:.|.:||.    :....:|.|:..|.    .|::::|..||...||.....
  Fly   767 NELLPNVEETGDVSICLHERDF----QIGVTILDNIISCMDRSYSLMLIISSKFLLSHWCQFEMY 827

Human   244 EGLCRLLELTRRPIFITF---EGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFWKEVQL 305
            ....|:.|:::..:.:.|   ..:|:.|     :.|:....:.|.:.| |.:......|||.::.
  Fly   828 LAQHRIFEVSKEHLILVFLEDIPRRKRP-----KTLQYLMDVKTYIKW-PTAKEDRKLFWKRLKR 886

Human   306 AL 307
            :|
  Fly   887 SL 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGIRRXP_005253101.1 Ig 8..111 CDD:299845 8/40 (20%)
TIR 165..311 CDD:279864 36/150 (24%)
Toll-9NP_001246846.1 leucine-rich repeat 157..185 CDD:275380
LRR_8 262..322 CDD:290566
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..356 CDD:275380
LRR_8 <344..387 CDD:290566
leucine-rich repeat 357..381 CDD:275380
leucine-rich repeat 382..397 CDD:275380
leucine-rich repeat 405..430 CDD:275380
LRR_8 431..488 CDD:290566
leucine-rich repeat 432..453 CDD:275380
LRR_RI <449..536 CDD:238064
leucine-rich repeat 454..477 CDD:275380
LRR_8 477..536 CDD:290566
leucine-rich repeat 478..501 CDD:275380
leucine-rich repeat 502..525 CDD:275380
TIR 751..891 CDD:214587 36/150 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.