Sequence 1: | XP_005253101.1 | Gene: | SIGIRR / 59307 | HGNCID: | 30575 | Length: | 504 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246846.1 | Gene: | Toll-9 / 40245 | FlyBaseID: | FBgn0036978 | Length: | 900 | Species: | Drosophila melanogaster |
Alignment Length: | 262 | Identity: | 58/262 - (22%) |
---|---|---|---|
Similarity: | 107/262 - (40%) | Gaps: | 41/262 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 70 VKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLL 134
Human 135 AALLYVKCRLNVLLWYQ----------------DAYGEVEIND-GKLYDAYVSYSDCPEDRKFVN 182
Human 183 FILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCR----RLIVVLSDAFLSRAWCSHSFR 243
Human 244 EGLCRLLELTRRPIFITF---EGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFWKEVQL 305
Human 306 AL 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SIGIRR | XP_005253101.1 | Ig | 8..111 | CDD:299845 | 8/40 (20%) |
TIR | 165..311 | CDD:279864 | 36/150 (24%) | ||
Toll-9 | NP_001246846.1 | leucine-rich repeat | 157..185 | CDD:275380 | |
LRR_8 | 262..322 | CDD:290566 | |||
leucine-rich repeat | 264..287 | CDD:275380 | |||
leucine-rich repeat | 288..311 | CDD:275380 | |||
leucine-rich repeat | 312..356 | CDD:275380 | |||
LRR_8 | <344..387 | CDD:290566 | |||
leucine-rich repeat | 357..381 | CDD:275380 | |||
leucine-rich repeat | 382..397 | CDD:275380 | |||
leucine-rich repeat | 405..430 | CDD:275380 | |||
LRR_8 | 431..488 | CDD:290566 | |||
leucine-rich repeat | 432..453 | CDD:275380 | |||
LRR_RI | <449..536 | CDD:238064 | |||
leucine-rich repeat | 454..477 | CDD:275380 | |||
LRR_8 | 477..536 | CDD:290566 | |||
leucine-rich repeat | 478..501 | CDD:275380 | |||
leucine-rich repeat | 502..525 | CDD:275380 | |||
TIR | 751..891 | CDD:214587 | 36/150 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |